structures suggest ving suggest that s should

... 28The sides of a square measure 8 cm What is the perimeter of the square?How many sides are there on 5 squares? What is the total perimeter of the five squares? 8cm Trang 29A box of sweets costs ... corners Trang 16How many road wheels are there on 3 cars? What about 14 cars? What about 27 cars? Trang 17A farmer has 5 sheep, 7 cows and 12 chickens How many animals has he got? How many legs do ... pieces remain? Trang 9Eggs are sold in dozens What is half a dozen? What is 3 dozen? How many eggs are 3 and a half dozen? Trang 10A book costs £11.70 If I save £1.50 per week, how many weeks will

Ngày tải lên: 18/07/2017, 10:45

... 28The sides of a square measure 8 cm What is the perimeter of the square?How many sides are there on 5 squares? What is the total perimeter of the five squares? 8cm Trang 29A box of sweets costs ... corners Trang 16How many road wheels are there on 3 cars? What about 14 cars? What about 27 cars? Trang 17A farmer has 5 sheep, 7 cows and 12 chickens How many animals has he got? How many legs do ... pieces remain? Trang 9Eggs are sold in dozens What is half a dozen? What is 3 dozen? How many eggs are 3 and a half dozen? Trang 10A book costs £11.70 If I save £1.50 per week, how many weeks will

Ngày tải lên: 18/08/2017, 22:34

... and asks Ss to listen to the tape twice -Asks Ss to listen and repeat in chorus three times -Lets Ss practice the sentences in pairs -Gets some pairs to read it aloud *Structures: That’s the ... times -Lets Ss practice the sentences in pairs -Gets some pairs to read it aloud *Structures: Is the school big?  Yes, it is No, it isn’t It’s small. - Explains the meaning of these sentences ... groups, then individual - Checks the students’ understanding of new words by Slap the board -Plays the recording and asks Ss to listen to the tape twice -Asks Ss to listen and repeat in chorus three

Ngày tải lên: 10/12/2017, 03:49

... 6But her mother was an admirable housekeeper—she didn’t want any help; andthe last cook had left as a direct result of her culinary experiments in the line ofdesserts She could count the laundry, but that was only twice a week Theycould dismiss the second maid, of course, and let her sweep and wash dishes—things like that This suggestion, too, had been vetoed—brushed aside as something not to beconsidered ... Like Gentle Jane in “Patience”:Gentle Jane was as good as gold; She always did as she was told; And when she grew up she was given in marriage To a first-class Earl who keeps his carriage Everything she had read, excluding, of course, text-books such as algebra andJulius Caesar and “The Ancient Mariner” and Latin prose—all the carefullysupervised fiction she had read had supported this Christmas-tree theory ... What a lot of lies they had told her, to be sure, those representatives of authority!Her whole education had been a sort of pious fraud Ever since she could remember, she had been learning little lessons, practising little accomplishments,upon the tacit understanding that the world was simply a Christmas tree, and that

Ngày tải lên: 07/03/2020, 19:09

... Trang 2Thursday , November 19 th 2015 Unit 7: That’s my school Lesson 2: 1, 2, 3 Warm up and review. Trang 3Is your school big? Yes, it is. Is your classroom big? No, it isn’t It’s small. 1 ... It’s small. 1 Look, listen and repeat. Trang 42 Point and say.Trang 5Is the ? Yes, it is.No, it isn’t It’s 2 Point and say. Trang 6school, new / yesa Trang 7…… gym, big/ yes b Trang 8…… ………… ... ………… library, old / no, new c Trang 9………… ………… playground, large/ no, small d Trang 103 Let’s talk.Trang 11Play game: Slap the board

Ngày tải lên: 10/02/2021, 08:47

... picture she has painted. Well done, Hoa That’s very kind of you. Trang 91 9He has just scored a goal. Trang 101 10She has just won the first prize in the Beauty contest. Trang 111 11He has just won ... a pack of sweets You will get mark 10 if you list 5 celebrations you know You will get an applause from your classmates Trang 31 3- That’s a great picture - That’s an excellent result - Let ... Thanks. D – Nam: Have you finished your English speaking contest ?. E – Nam: Well done, Nga. C – Nga: Yes, I did I got mark 10 F – Nga: Yes, I have just finished it. That’s an excellent result!

Ngày tải lên: 19/04/2021, 18:55

... 6But her mother was an admirable housekeeper—she didn’t want any help; andthe last cook had left as a direct result of her culinary experiments in the line ofdesserts She could count the laundry, but that was only twice a week Theycould dismiss the second maid, of course, and let her sweep and wash dishes—things like that This suggestion, too, had been vetoed—brushed aside as something not to beconsidered ... Like Gentle Jane in “Patience”:Gentle Jane was as good as gold; She always did as she was told; And when she grew up she was given in marriage To a first-class Earl who keeps his carriage Everything she had read, excluding, of course, text-books such as algebra andJulius Caesar and “The Ancient Mariner” and Latin prose—all the carefullysupervised fiction she had read had supported this Christmas-tree theory ... What a lot of lies they had told her, to be sure, those representatives of authority!Her whole education had been a sort of pious fraud Ever since she could remember, she had been learning little lessons, practising little accomplishments,upon the tacit understanding that the world was simply a Christmas tree, and that

Ngày tải lên: 01/05/2021, 19:32

... messages across linguistic and cultural barriers”. Obviously, translation can be a bridge to link countries to counties, societies to societies It has a very essential task to make those whose ... there is no sign of the future form b The use of simple past tense The simple past tense is normal used to express actions that completed in the past In regular verbs, the simple past tense is formed ... (http://vietnamnews.vnanet.vn/) Instead of using simple past tense, most English news headlines use the simple present form to express actions that completed in the past The aim of this is to give the readers

Ngày tải lên: 05/06/2022, 13:12

... answers Swap and check their answers before checking as a class Listen and say Do the task Swap and check their answers before checking as a class Read aloud the answers school, library classroom, ... It’s small That’s down, please! No, it isn’t It’s small Is it big? Trang 4Unit 7 That’s my schoolLesson 1 (4-6) TIME TEACHER’S ACTIVITIES STUDENTS’ ACTIVITIES CONTENT 5’ 30’ WARM – UP : slap ... a class Call pupils to read aloud Say out the question and answer Sing Say Listen Listen, do the task and check their answers Swap and check their answers before checking as a class Look

Ngày tải lên: 23/03/2023, 11:41

... is c) she is Task 4 1 school 2 new 3 classroom 4 small 5 playground Trang 10Task 5.1 X 2 V 3 X 4 X 5 V Task 6. 1 very 2.it is 3.new 4.and 5.is Task 7 1 Is 2 Is 3 Is 4 Are, am 5 am 6 is 7 is ... my school That's the playground. Examples: 1 That’s the library 2 Trang 5That’s my classroom   3 That’s the playground   4 The computer room is big   5 The library isn’t big It’s small     Task ... am 6 is 7 is 8 is 9 are, are Task 8. 1 This is my classroom 2 Who is she? 3 He is my friend 4 Stand up please 5 Hello, my name is Hoa 6 That is the gym 7 Is your school big? 8 Is the computer

Ngày tải lên: 04/04/2023, 07:41

... old /new. 4 The gym is new /big. Look at my school It is beautiful That is my classroom It is big And that is the computer room It is new but small Look at the library It is large and new And ... sentencesA: Is the + (khu vực) + (tính từ) ? B: Yes, it is. No, it isn’t It’s + (tính từ). 2 Point and say. Trang 11A: Is the ? B: Yes, it is. school khu vực tính từ new Trang 12A: Is the ... bigB: Yes, it is. Trang 13A: Is the _? library oldB: No, it isn’t It’s new Trang 14A: Is the _? playground largeB: No, it isn’t It’s _ small Trang 16Classroom, big/ yesLibrary,

Ngày tải lên: 12/09/2023, 03:22

... controls? 5  Where's the flusher? 5  Brake release 6 3 CONTROL THAT’S WORK ON UNEXPECTED WAYS 7  How do you raise the window? 7  Understand the umbrella stand? 8 4 CONTROL THAT ... INCOMPATIBLE MAPPING OF CONTROLS TO DEVICES 4  Guess which switch controls the projector screen? 4  Entryway 4   Stove top controls 4 2 UNEXPECTED PLACEMENT OF CONTROLS 4   How do you ... THAT ARE TOO CLOSE TOGETHER 9  Oops, I popped the trunk lid by mistake! : 9 5 INCONSISTENT CONTROL ACTIVATION 9  How do you unlock the door? 9  Windshield wiper controls 10 Trang 31

Ngày tải lên: 07/02/2025, 10:41

... advantages and disadvantages of each channel choose the most suitable channel You should:  Use varieties of distribution channels as: retail stores, telephone sales, websites,….  Help customers easy ... yourself Trang 101.5 Analysis• Much effort is directed at both internal research, such as discussions with production and purchasing personnel, and external marketing research, such as customer ... and distributor surveys,… • Much effort is directed at both internal research, such as discussions with production and purchasing personnel, and external marketing research, such as customer

Ngày tải lên: 15/04/2018, 00:34

... Prepare students for more advanced study of the structures 5 Gives students a sense of accomplishment as they progress through the course 6 CONCLUSION 7 REFERENCE 8 Trang 2Many young students can still ... English that they can grasp now or that is just beyond their current level" However, some educators argue that teachers should only use materials that introduce students to linguistic structures ... benefits to students as follows: Helps students learn and remember language structures more easily Students learn and recall language structures more easily when they are only exposed to ones that they

Ngày tải lên: 22/03/2023, 16:27

... one Basically, ideas which is chosen must be suitable with the resources Good idea will support the strategy of business, reduce unnecessary cost or use the available resources without losing ... doesn’t matter Small business should take the idea from inside the company because it cost less money and time + Step 2: Screening idea Not every idea can be done, so we should choose the posible ... to choose the good one The ideas might come from inside or outside the company, but it doesn’t Trang 5Small business should take the ideas from inside the company because it costs less money

Ngày tải lên: 20/06/2014, 16:07

... processes can not be assessed accurately  Select all the criteria for the evaluation process: Because when developing assessment criteria (characteristics should evaluate employees) and assess ... prejudices influence the assessment 7 Construction employee evaluation program  Selection and design assessment methods  Selection of auditors  Define cycle assessment  Interview assessment ... easy to understand, easy to use as the standard and scale very clear, easily understandable tool for the evaluation and assessment methods so this is usually widely used in the business small and

Ngày tải lên: 14/05/2015, 14:41

... purpose of the systems archetypes is to recondition our per-ceptions, so as to be more able to see structures at play, and to see the leverage in those structures Once a systems archetype is identified, ... produce a desired result It creates a spiral of success but also creates inadvertent secondary effects (manifested in a balancing process) which eventually slow down the success MANAGEMENT ... These changes were necessary to overcome the distrust that lay behind traditional goals of maintaining multiple sources of supply and multiple customers In successful cases, man-agers had to ignore

Ngày tải lên: 17/10/2013, 18:20

... present the results of proteomics computational analyses that suggest that GP64 superfamily members are class III penetrenes Materials and Methods Sequences Sequence and structural comparisons ... KGDLMHIQEELMYENDLLKMNIELMHAHINKLNNMLHDLIVSVAKVDERLIGNLMNNSVSSTFLSDDTFLLMPCTNPPAHTSNCYNNSIYKEGRWVANTDSSQCIDFSNYKELA-IDDDVEFWIPTIGNTTYHDSWKDASGWSFIAQQKSNLITTMEN F THOV GP v ISAP SQTSVDVSLIQDVERILDYSLCQETWSKIRAGLPISPVDLSYLAP KNPGTGPAFTIINGT ... computational analyses suggest that the carboxyl terminal glycoproteins (Gc) of bunyaviruses, and similar proteins of tenuiviruses and a group of Caenorhabditis elegans retroviruses, are also class II penetrenes...

Ngày tải lên: 20/06/2014, 01:20

... million USD to 35.90 million USD WHICH COMPANY SHOULD GO TO OVERSEA ? TH TRUE MILK Strengths Threatens TH Milk Opportunities Weaknesses STRENGTH Marketing mix:  Product: With the slogan “fresh milk ... environment such as Laos, Thailand, Myanmar, Cuba Difficulty:  It is applied when a company faces up with the pressure on decreasing the cost and satisfies the requirements of the local  Most of ... consumers”  Good product locating in consumers: TH true milk- True Happiness, true milk With the strong commitment for the sakes of consumer, TH true MILK has tried its best to exploit its advantages...

Ngày tải lên: 12/07/2014, 11:07