4—requirements for anchor identification p 355 2 5

iec 60269-2-1 low-voltage fuses - supplemetary requirements for fuses for use by authorized perso

iec 60269-2-1 low-voltage fuses - supplemetary requirements for fuses for use by authorized perso

... TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT ,F, ,

Ngày tải lên: 25/12/2013, 10:47

264 754 4
iec 60269-2 low-voltage fuses - supplementary requirements for fuses for use by authorized person

iec 60269-2 low-voltage fuses - supplementary requirements for fuses for use by authorized person

... A 10 12 16 20 25 32 40 50 63 80 1O0 1 25 160 20 0 25 0 3 15 400 50 0 630 800 O00 1 25 0 Cross-sởctionai area rnmZ 1 ,5 1 ,5 23 2. 5 2. 5 10 16 25 25 35 50 70 95 120 1 85 24 0 x 150 or x (30 x ) x 1 85 or x ... pour les essais des ộlộments de remplacement aM Courant assignộ A Section 10 12 16 20 25 32 40 50 63 80 1O0 1 25 160 20 0 25 0 31 400 50 0 630 800 O00 1 25 0 1 .5 1,s 13 2, s 2, s 2. 5 10 16 25 25 35 50 ... the prokction o semiconductordevices f 28 2- High-voltagefuses P r 1: Current-limiting fuses at 28 2-1 (1994) 28 2 -2 (19 95) Partie Coupe-circuit expulsion 28 2 -2 (19 95) P r 2: Expulsion fuses at 28 2-3...

Ngày tải lên: 25/12/2013, 10:53

30 320 3
iec 60269-4-1 low-voltage fuses - supplementary requirements for fuse-links for the protection of

iec 60269-4-1 low-voltage fuses - supplementary requirements for fuse-links for the protection of

... 31,8 5 ,2 25, 8 9,1 12, 3 22 5 – 800 99 ,2 70,6 79 55 ,5 42, 1 51 ,2 6,8 38 ,5 12, 3 20 ,2 35 – 60 82, 6 62, 7 67 ,5 54 42, 9 21 3,6 19 ,5 9,1 13,6 65 – 100 93 ,5 73,0 79 66 ,5 55, 6 25 ,8 3,7 19 ,5 9,3 17,9 110 – 20 0 ... 76 ,5 66 ,5 55, 7 31,4 5 ,2 25, 8 9,1 15, 5 22 5 – 400 111,9 83,3 89 68 54 ,8 38 ,5 6,8 25 ,8 11,4 19,9 450 – 600 1 15, 6 86 ,5 91 ,5 69 58 51 ,2 6,8 38 ,5 12, 3 20 ,2 700 – 800 166 110,0 128 85, 5 58 63,9 10,1 51 ,2 ... 5 ,2 25, 8 9,1 12, 3 22 5 – 800 99 ,2 70,6 79 55 ,5 42, 1 51 ,2 6,8 38 ,5 12, 3 20 ,2 35 – 60 82, 6 62, 7 67 ,5 54 42, 9 21 3,6 19 ,5 9,1 13,6 65 – 100 93 ,5 73,0 79 66 ,5 55, 6 25 ,8 3,7 19 ,5 9,3 17,9 110 – 20 0...

Ngày tải lên: 25/12/2013, 10:54

42 422 2
iec 60269-4 low-voltage fuses - supplementary requirements for fuse-links for the protection of s

iec 60269-4 low-voltage fuses - supplementary requirements for fuse-links for the protection of s

... about this message: please call the Document Policy Group at 303-397 -22 95 8 10 10 10 10 12 12 12 12 12 14 14 14 14 18 18 20 20 20 20 20 20 20 20 20 22 22 24 26 28 32 36 39 42 54 `,,`,`,``,````,,,,,`,````,```-`-`,,`,,`,`,,` ... the 12tcharacteristicsand overcurrent discrimination 9 11 11 11 11 13 13 13 13 13 15 15 15 15 19 19 21 21 21 21 21 21 21 21 21 23 23 25 27 29 33 37 FIGURES 39 APPENDIX- ... Page 10 2. 2.1O Catộgorie demploi (dun ộlộment de remplacement) Supprimer ce paragraphe Page 16 Ajouter, aprốs le paragrap e 5. 6.4 2, le nouveau paragraphe 5. 7.1 su .ant: 5. 7.1 Pouvoir de coupure...

Ngày tải lên: 25/12/2013, 10:55

87 406 1
iec 60439-2 low-voltage switchgear and controlgear assemblies - particular requirements for busba

iec 60439-2 low-voltage switchgear and controlgear assemblies - particular requirements for busba

... température de +20 OC,par mètre de longueur: - phase phase - ßbO phN phase neutre - ßbO phPEN phase PEN - - ßbO phph ßbO phPE phase PE la résistance ohmique moyenne des conducteurs considérés, pour ... considérés, pour le courant assigné INc, la fréquence assignée f , par mètre de longueur: - xb phph phase phase - xb phN phase neutre - Xb phPEN phase PEN - Xb phPE phase PE NOTE Ces valeurs peuvent ... assigné INC, la température de stabilisation thermique 8, du système, par mètre de longueur: - ßbl phph phase phase - ßbl phN phase neutre - ßbl phPEN phase PEN - ßbl phPE phase PE - la réactance...

Ngày tải lên: 25/12/2013, 11:05

74 828 14
iec 60439-4 low-voltage switchgear and controlgear assemblies - particular requirements for assem

iec 60439-4 low-voltage switchgear and controlgear assemblies - particular requirements for assem

... applicable (see 2. 1.1.3) 2. 5 .2 ASSEMBLY outdoor installation for Not applicable (see 2. 1.1.3) 2. 5. 3 Stationary ASSEMBLY Not applicable 2. 5. 4 Movable ASSEMBLY Not applicable 2. 5. 5 Transportable (or ... s'applique pas (voir 2. 1.1.3) 2. 5. 3 ENSEMBLE fixe Ne s'applique pas 2. 5. 4 ENSEMBLE dộplaỗable Ne s'applique pas 2. 5. 5 EC transportable (ou semi-fixe) EC prộvu pour ờtre utilisộ un emplacement donnộ ... 2. 4 .2) 2. 3.4 Canalisation prộfabriquộe Ne s'applique pas 2. 5. 1 ENSEMBLE pour installation l'intộrieur Ne s'applique pas (voir 2. 1.1.3) 2. 5 .2 ENSEMBLE pour installation l'extộrieur Ne s'applique pas...

Ngày tải lên: 25/12/2013, 11:07

56 514 5
Báo cáo khoa học: Structural requirements for the apical sorting of human multidrug resistance protein 2 (ABCC2) potx

Báo cáo khoa học: Structural requirements for the apical sorting of human multidrug resistance protein 2 (ABCC2) potx

... ( 151 0– 154 5) GFP–MRP2 GFP–MRP2D7 GFP–MRP2D11 GFP–MRP2D 15 GFP–MRP2D20 GFP–MRP2D 25 GFP–MRP2D 25 MAKE GFP–MRP2D50 GFP–MRP2D100 73 69 65 16 15 1 18 18 20 17 64 59 59 64 35 13 15 67 20 33 32 35 65 GKIIECGSPEELLQIPGPFYFMAKEAGIENVNSTKF ... Construct % Apical % Vesicles % ER C-Terminal sequence ( 151 6– 154 5) GFP–MRP2 GFP–MRP2D3 GFP–MRP2-T 154 3A GFP–MRP2D 15 GFP–MRP2D15TKF 73 64 67 16 21 18 13 16 17 21 23 17 67 58 GSPEELLQIPGPFYFMAKEAGIENVNSTKF ... A.F & Keppler, D (20 00) MRP2, a human conjugate export pump, is present and transports Fluo-3 into apical vacuoles of HepG2 cells Am J Physiol 27 8, G 52 2 –G531 Keppler, D & Konig, J (1997) Expression...

Ngày tải lên: 31/03/2014, 09:20

11 523 0
Converging Technologies for Improving Human Performance Episode 2 Part 4 pdf

Converging Technologies for Improving Human Performance Episode 2 Part 4 pdf

... Technologies for Improving Human Performance (pre-publication on-line version) 25 5 Productivity is a function of knowledge and skill, i.e., technology Growth in productivity depends on improved technology ... Technologies for Improving Human Performance (pre-publication on-line version) 25 3 Implications for the Future Clearly, the ability to build highly intelligent machine systems will have profound implications ... COGNITION TO ENHANCE HUMAN PERFORMANCE William A Wallace, Rensselaer Polytechnic Institute The purpose of this paper is to provide a rationale for a new program whose purpose would be the integration...

Ngày tải lên: 05/08/2014, 21:20

20 417 0
Advanced Mathematical Methods for Scientists and Engineers Episode 2 Part 4 ppsx

Advanced Mathematical Methods for Scientists and Engineers Episode 2 Part 4 ppsx

... , C2 and C2 C z dz = z3 − C1 z− + √ C2 z− C3 z− + = 2 + 2 + 2 z− √ √ √ z− z− z √ dz e 2 /3 z − e− 2 /3 z √ √ dz 2 /3 z − 9e z − e− 2 /3 z √ √ dz z − e 2 /3 z − e− 2 /3 z− 9 √ z e 2 /3 ... a lower and 53 0 upper bound for the series ∞ 1 dx ≤ x2 ∞ n=1 ≤1+ n2 ∞ 1≤ n=1 ∞ 1 dx x2 2 n2 1 Figure 12. 1: Upper and Lower bounds to In general, we have ∞ ∞ a(x) dx ≤ m ∞ n=1 1/n2 ∞ an ≤ am ... = and z = −1 Let C1 and C2 be contours around z = and z = −1 See Figure 11.6 We deform C onto C1 and C2 = C + C1 52 0 C2 -4 C1 C2 -2 C -2 -4 Figure 11 .5: The contours for (z +z+ı) sin z z +ız...

Ngày tải lên: 06/08/2014, 01:21

40 341 0
Specifications, Tolerances, and Other Technical Requirements for Weighing and Measuring Devices Episode 4 pptx

Specifications, Tolerances, and Other Technical Requirements for Weighing and Measuring Devices Episode 4 pptx

... 19 26 32 65 97 110 130 130 190 23 0 23 0 26 0 26 0 320 mg 10 15 20 25 30 40 5. 0 7.0 9.0 11.0 15 17 19 21 23 25 28 30 35 40 45 320 450 58 0 710 970 1190 120 0 1400 150 0 1600 1800 1900 23 00 26 00 29 00 50 ... 2. 5 2. 9 3.7 5. 4 mg 1 15. 0 1 25 .0 130.0 1 35. 0 1 45. 0 mg 155 .0 160.0 190.0 24 0.0 350 .0 oz 100 20 0 300 50 0 1000 grains 7.7 12. 3 15. 4 23 .1 38.6 mg 50 0.0 800.0 1000.0 150 0.0 25 00.0 2- 66 Handbook 44 - 20 07 ... 0 .20 0.30 0.40 0 .50 0.60 grains 0.06 0.10 0. 15 0 .20 0.30 0.40 mg 4 .5 6 .5 13.0 20 .0 25 .0 30.0 40.0 mg 4.0 6 .5 10.0 13.0 20 .0 25 .0 oz 10 oz 11 12 20 30 50 grains 1.8 1.9 2. 0 2. 1 2. 2 grains 2. 4 2. 5...

Ngày tải lên: 12/08/2014, 07:22

29 351 0
Longman-Grammar and Vocabulary for Cambridge Advanced and Proficiency (2)

Longman-Grammar and Vocabulary for Cambridge Advanced and Proficiency (2)

... reporting and interpreting Communicating Exam practice 13 21 8 22 0 22 2 25 2 • Syllabus map Unit one page 16 Grarnrnar Probiem tmses Present Perfect Present Perfect with other tenses; idiomatic phrases ... Exam practice 15 24 6 24 8 25 0 Reported speech Entry test 21 2 Progress test OVERVIEW 21 3 (testing contents of Units - 15) SECTION I SECTION Tenses in reported speech Report structures 21 4 21 6 Vocabulary ... Ernp hasis SECTION Dependent prepositions and prepositional phrases Expressing knowledge and belief 23 0 23 8 Verb cornplernentation Entry test SECTION I SECTION SECTION 20 6 20 8 Exam practice 12 210...

Ngày tải lên: 05/10/2012, 09:51

288 1,8K 23
Báo cáo y học: "Efficiency of vibration exercise for glycemic control in type 2 diabetes patients."

Báo cáo y học: "Efficiency of vibration exercise for glycemic control in type 2 diabetes patients."

... ml) 120 ± 25 126 ± 23 133 ± 57 Plasma [glucose] posttraining (mg / 100 ml) 1 15 ± 22 120 ± 22 122 ± 35 Significance n.s n.s n.s HbA1C At baseline the HbA1c amounted to 6,7 % ± 0 ,26 (FT), 6,8 % ... loads of 89 w ± 8 ,2 (pre) and 86 w ± 9,7 (post), 99 w ± 14,8 (pre) and 95 w ± 13,3 (post), 89 w ± 6 ,2 (pre) and 92 w ± 5, 9 (post) for FT, ST, and VT, respectively In contrast, at these loads heart ... group (number of subjects) Age (years) Weight (kp) Height (cm) Stretching (13) Strength (13) 63,3 ± 5, 9 62, 9 ± 7,3 62, 2 ± 4,0 88,6 ± 24 ,1 86 ,5 ± 14,7 83,3 ± 13,4 173 ± 14 ,2 1 72 ± 6,7 177 ± 7,2...

Ngày tải lên: 26/10/2012, 10:04

5 546 0
A research proposal submitted  in partial fulfillment of the requirements for the degree of Master of Business Administration

A research proposal submitted in partial fulfillment of the requirements for the degree of Master of Business Administration

... Heavy-users (nhu = 50 ) Differences Age % less 20 years 21 - 25 26 -30 31- 35 36-40 41- 45 more 45 years 4 .5 20 .5 15. 9 15. 9 20 .5 18 .2 4 .5 20 .0 20 .0 More people in 32. 0 age of 25 - 35 18.0 4.0 lower ratio ... % 42. 6 45 40 35 30 25 .6 25 17.6 20 15 9.1 10 1.7 2. 3 1.1 person Figure 3 .2: Family size 60 % 52 . 8 50 40 28 .4 30 20 10 6.8 5. 7 5. 7 0.6 23 more million 4 -5 million 3-4 million 2- 3 million 1 -2 million ... salespersons shopping atmosphere 3 .55 11.4 2. 3 4.34 52 . 0 4.0 product display 3.80 18 .2 0.0 4. 52 66.0 0.0 10 air conditioning 3.66 20 .5 4 .5 4. 12 30.0 2. 0 11 check out 3.61 20 .5 6.8 4.30 40.0 2. 0 12...

Ngày tải lên: 13/04/2013, 10:30

51 1K 3
Unit 4: Lesson 3: B1-5/ p. 47-48

Unit 4: Lesson 3: B1-5/ p. 47-48

... 10th Unit 4: Lesson 3: B1 -5/ p 47-48 III Dialogue: Vocabulary: - grade: l p - floor : tÇng ( lÇu ) Listen to the tape: Complete this table: Grade Thu Phong Class 7c 6A Thu Phong Classroom’s floor ... Unit 4: Lesson 3: B1 -5/ p 47-48 I Ordinal numbers: the first = 1st the second = 2nd the third = 3rd the fourth = 4th the fifth = 5th II Listen and repeat: the sixth = 6th the seventh ... … am P: I … in class 6A is T Where … your classroom ? P: It’ s on the first floor … Unit 4: Lesson 3: B1 -5/ p 47-48 V Practice with a partner: Which grade are you in ? How many floors does your...

Ngày tải lên: 23/06/2013, 01:26

9 678 1
Unit 4: Lesson 5: C1-3/ p.49

Unit 4: Lesson 5: C1-3/ p.49

... morning? - S2: I get up Then I - S3: Every morning, he/she gets up Then he/she gets dressed Unit 4: Lesson 5: C1-3/ p. 49 III Practice: Picture drill Unit 4: Lesson 5: C1-3/ p. 49 III Practice: ... Lesson 5: C1-3/ p. 49 II Model sentences: The present simple - What does Ba every morning? he she - Ba brushes his / her teeth He gets up She has breakfast goes to school Unit 4: Lesson 5: C1-3/ p. 49 ... singular posernal pronouns: (he, she, it) need to add: “-s” or “-es” -Adding “-es” with the verbs have the end: “ o, s, x, ch, sh” Unit 4: Lesson 5: C1-3/ p. 49 III Practice: have breakfast get up brush...

Ngày tải lên: 23/06/2013, 01:26

21 464 0
Unit 4: Lesson 6: C4-7/ p.50-51

Unit 4: Lesson 6: C4-7/ p.50-51

... 6: C4-7/ p. 50 -51 IV Practice: Eg: * PICTURE DRILL: C.7 P. 51 S1: What time you get up? S2: At six o’clock 6. 15 6.30 6 .20 7.00 6 .50 Unit 4: Lesson 6: C4-7/ p. 50 -51 IV Practice: C6 /p. 51 Read the ... C4-7/ p. 50 -51 I Number dictation: 1.10 4.30 5 .20 3. 15 6.40 7.40 2. 55 11 .50 10.30 12. 25 II Vocabulary: - the time: thêi gian Eg: ten o’clock, half past ten - late (adj): trÔ, muén to be late for ... and crosses O1 O2 O3 O4 O5 O6 O7 O8 O9 X X X o o o 6.10 O X 7.00 6.30 O X 12. 0 7 .50 5. 45 O X O X O O X X 3. 15 9.10 4 .20 X1 X2 X3 X4 X5 X6 X7 X8 X9 Unit 4: Lesson 6: C4-7/ p. 50 -51 Remember - What...

Ngày tải lên: 23/06/2013, 01:26

14 427 1
kiem tra 45 p chuong 2

kiem tra 45 p chuong 2

... Câu 26 : Trên mặt thoáng chất lỏng có hai nguồn kết h p A B cách 5cm, phương trình dđ A B có dạng: u = a cos 60πt (cm) Vận tốc truyền sóng mặt thoáng v = 60cm/s Pha ban đầu sóng tổng h p 5 5 ... ) Li độ vận tốc vật thời điểm t= 0 , 25 s : A 2cm 4π cm/sB - 2cm 8π cm/sC - 2cm - 8π cm/sD 4cm 16π cm/s Câu 29 : Một lắc đơn dao động điều hòa nơi có g = 10m/s 2, chiều dài dây treo l = 1,6m với ... có li độ : A 8cm B -8cm C 9cm D 6cm Câu 22 : Một dây đàn có chiều dài L, hai đầu cố định Sóng dừng dây có bước sóng dài A L/4 B L /2 C L D 2L Câu 23 : Chọn phát biểu Vận tốc truyền âm:A Có giá trị...

Ngày tải lên: 25/06/2013, 01:26

3 318 0
w