like and dislikes of a person

... straight lines and are labelled; b-strands are indiindi-cated with arrows and are labelled A–H A single a-helix is indicated with a rectangle The residues that are strongly conserved between transthyretins ... allantoinase and dihydrooratase [32] Cyclic amidohydrolases share a number of physicochemical characteristics These characteristics include quaternary, tertiary, secondary and primary structure as ... find-ings regarding the identification and distribution of TLP genes in nature, the structural and functional characterization of the TLP from various organisms, and the evolution of TLP and transthyretin

Ngày tải lên: 07/03/2014, 00:20

... mammary gland during pregnancy may act as a factor inducing functional mammary gland differentiation mediated by activation of Jak2 and Stat5 Fig 2 Induction of Jak 2 and Stat5 activation and b-casein ... transgenic mouse, fat-1 can convert n-6 to n-3 fatty acids and Table 1 Analyses of fatty acid ratio and relative contents of n-3 PUFAs EPA, DPA, and DHA in mammary glands Whole inguinal mammary ... of total PUFA contents of combination of EPA, DHA, and DPA Data represent the means ± SD of three mammary gland samples Statistical comparisons for both ratio 1 and ratio 2 in MRG glands relative

Ngày tải lên: 16/03/2014, 10:20

... metallo-endoprotease of Serratia marcescens(serralysin), are the alkaline protei-nase of Pseudomonas aeruginosa, the ZapA metallo-protease of Proteus mirabilis and proetases A, B, C, G and W of various ... internal standard, because it was not hydrolysed by PrtA Peak areas were normalized with the internal standard, and the degree of cleavage was calculated from the reduction in the normalized area of ... of such a substrate based on analysis of PrtA cleavage site specificity, and kinetic characterization of PrtA activity on the new substrate Results and Discussion Identification of PrtA cleavage

Ngày tải lên: 23/03/2014, 09:20

... great potential to serve as a model for human disease that range from heart failure and vascular disease to fields as diverse as osteoporosis, renal failure, Parkinson’s disease, diabetes and cancer ... linkages at the sacrolemma of striated muscle 92 Trang 7LIST OF ABBREVIATIONS aa amino acid AP alkaline phosphatase arp acidic ribosomal protein gene BAC bacterial artificial chromosome BCIP ... polymerase chain reaction PFA paraformaldehyde POZ poxvirus and zinc finger RACE rapid amplication of cDNA ends RAPD randomly amplified polymorphic DNA RH radiation hybrid RNA ribonucleic acid

Ngày tải lên: 03/10/2015, 20:57

... the rate of heat release With advancement of injection by 3 degrees, the peak rate of heat release is at 357 degree crank angle and on retarding by 3 and 6 degrees, the peak heat release rate ... development of biofuel, Planning commission, Government of India, 2003 [12] S Jindal, B.P Nandwana, N.S Rathore Comparative evaluation of combustion, performance and emissions of Jatropha methyl ester and ... of -exhaust, -cooling water and -calorimeter water inlet and outlet and load on the engine These signals are interfaced to computer through data acquisition system and the software displays the

Ngày tải lên: 05/09/2013, 16:11

... exergoeconomic analysis of the system at each iteration and on several qualitative and quantitative objective criteria, a hierarchical classification of the system components, and the associated subsets of ... analysis of the Trang 8system at the beginning of each iteration is performed The analysis provides information to hierarchically classify the components as main, secondary, and remainder, and ... main decision variables subgroups associated with the main and secondary components The subgroups may have common decision variables, and their sizes may vary Appropriate values for the parameters

Ngày tải lên: 05/09/2013, 16:30

... central (what language does and how language does it)rather than placing the elements of language and their combination (known as structural approaches) as central With in SFL, language is analyzed ... aspect of language 2.4 Metafunctions Halliday developed a theory of the fundamental functions of language into three broad metafunctions: ideational, interpersonal, and textual Each of the three ... intonation, rhythm, and syllabic andphonemic articulation These four strata has a close relation which is that of realization,phonology realizes lexico-grammar, which realizes semantics, which realizes

Ngày tải lên: 07/09/2013, 13:48

... contains typical archaeal promoter elements The sequence AAAGGTTAATATA was found 64 bp upstream of the start codon of AF499; this corresponds to the BRE element and the box A element of archaeal promoters ... with an apparent molecular mass of 53 kDa appears as a double band in unboiled samples (lanes A1 and B1). Table 1 N-Terminal sequences of the polypeptides of the purified enzyme N-Terminal sequences ... overlap by 3 bp) The region 81–65 bp upstream of the start codon of AF499 was identified as an archaeal promoter element by sequence analysis The sequence AAAGGTTAATATA shows a high level of identity

Ngày tải lên: 21/02/2014, 03:20

... Trang 1analysis of a target for fusidic acidYang Chen, Ravi Kiran Koripella, Suparna Sanyal and Maria Selmer Department of Cell and Molecular Biology, Uppsala University, Sweden ... mutation sites are displayed as side chains and located in domain III, domain V and the interface of domains G, III and V (B) Mutation sites in domain are facing the ribosome, and the four-stranded b-sheet ... which coordinates the a-phosphate and b-phosphate, and two so-called switch regions, which coordinate the c-phosphate and change conformation between a tense GTP state and a relaxed GDP state [17]

Ngày tải lên: 06/03/2014, 22:21

... Chal-font, UK) Dexamethasone, apotransferrin, Gly-Gln, Ala-Ala, Ala-Ala-Ala-Ala, Lys-Lys, d-aminolevulinic acid, cefadroxil, Gly, Pro-Ala, 8-aminooctanoic acid and Gly-Sar were from Sigma-Aldrich ... cells was inhibited not only by unlabeled Bip-Pro itself, but also by well known sub-strates of H+⁄ peptide cotransporters, such as Gly-Sar, Ala-Ala, Lys-Lys, Ala-Asp, d-Phe-Ala, Ala-Ala-Ala, d-aminolevulinic ... calculated as the difference of the currents measured in the presence and the absence of substrate Trang 9Calculations and statisticsAll data are given as the mean ± standard error of three to

Ngày tải lên: 07/03/2014, 05:20

... Intensity Discharge (HID) Headlamps Annex Certificate of Compliance with Exhaust Emission Standards – Submission Format B Trang 2IMPORTATION AND REGISTRATION OF NEW AND USED CARS IN SINGAPORE Vehicle ... diesel-driven car); or c) Get your car tested and certified by any of LTA/NEA-recognised vehicle test laboratories (listed in Annex A) The laboratories are required to issue a certificate of compliance and ... or b) A letter of certification from the vehicle manufacturer that the car complies with the Euro II emission standard and above (for petrol-driven car) or Euro IV emission standard and above

Ngày tải lên: 07/03/2014, 11:20

... Receptor (RXR) actsas a critical partner and thus plays a central role in a variety of nuclear signaling pathways [3–6] Schistosoma mansoni is a multicellular eukaryotic parasite with a complex life ... SmNR1 contains an autonomous transacti-vation function (AF1) in the A⁄ B domain as demonstrated in a yeast one-hybrid assay; it interacts with SmRXR1 in a yeast two-hybrid assay and in a glutathione ... SmRXR1 can interact with mammalian coac-tivators of transcription, and S mansoni coaccoac-tivators of transcription may have a similar mechanism to SmNR1⁄ SmRXR1 Recently four NR coactivators,

Ngày tải lên: 07/03/2014, 11:20

... (5¢-CGTCAAGGAGAAAAAACCCCGGATCT AAAAAATGGAGCGAAGGAACCACAG-3¢) and (5¢-AG CTGCCTGCAGGTCGACTCTAGAGGATCCTAACCAA AAAAAACCCCGGATCTAAAAAATGGAGCAGAAAC CCTGCAGGTCGACTCTAGAGGATCTCAAGCCAGT TGGGGTGTTTGGGCAAC-3¢) ... was obtained from pJH2-SSTR2 by homologous sequence, using primers (5¢-CGTCAAGGAGAAAAAAC CCCGGATCTAAAAAATGGAGCAGAAACTCATCTC TGAAGAGGATCTG-3¢) and (5¢-GCATGCCTGCAGG TCGACTCTAGAGGATCTCAAGCCAGTGACCGCCT ... Trang 8activity By taking advantage of structural and func-tional similarities between yeast and mammalian GPCR signaling pathways, this assay enables the quantitative measurement of receptor activity,

Ngày tải lên: 07/03/2014, 16:20

... (5¢-GGCCTCATGAAGAAAAAGGTCGTCA TAATT-3¢), and TG101 (5¢-GGCCAAGCTTCTAGAAC TTGAGAACCCTAGC-3¢) (for the P horikoshii CoADR), and TG104 (5¢-CGCGCCATGGAAAAGAAAAAGGTA GTCATAA-3¢) and TG105 (5¢-CGCGGTCGACCTAGAA ... blast and tfasta analysis of the phCoADR revealed a significant level of identity to putative NADH oxidases from hyperthermophiles and bacterial NADH oxidases from mesophilic sources (Fig 1) Of ... demonstrate that this enzyme is not likely to act as an NADH oxidase in vivo, instead act-ing as a CoADR This is only the second demonstra-ted CoA reductase activity, and the first appearance of this activity

Ngày tải lên: 07/03/2014, 17:20

... purification and characterization of F 4¢-OMT from carnation The hypo-thesis that this enzyme may have a role in carnation defensive processes against Fod infection is likewise discussed Materials and ... that it consists actually of a unique enzymatic protein Molecular mass and pI determination of F 4¢-OMT The molecular mass of the pure enzyme was calculated both through gel-filtration and PAGE ... at 25C The solvent was a mixture of 0.05M NaPi buffer, pH 3, and acetonitrile (6 : 1, v/v); separation was performed isocratically, at a flow rate of 1 mLÆmin)1, and the volume of injected samples

Ngày tải lên: 08/03/2014, 08:20

... BASI protein of Brassica, spinach, barley and A thaliana, PR1 of Phaseolus and MHF of A thaliana These proteins belong to the 2Cys-Prx subfamily All plant 2Cys-Prx proteins, except BASI of barley, ... Barley BAS] - ~ MAALQSASRSSAVAFSRQARVAPRVAAS VARRSLVVRA c======~~~~=~~~~~~~~~~~~~~~~~~ DARAEFVARS Arabidopsis BAS] MASVASSTTLISSPSSRVFPAKSSLSSPSVSFLRTLSSPSASASLRSGFARRSSLSSTSRRSFAVKA Pl ... analyses was isolated as described above and separated in a 1.3% agarose/formaldehyde gel The RNA was blotted to a nylon membrane (ZetaProbe, Bio-Rad) by alkaline transfer, UV-crosslinked, and

Ngày tải lên: 08/03/2014, 16:20

... xylosoxydans A-6 N-acyl- D -Asparate amidohydrolase; A-6-D50061: Alcaligenes xylosoxydans ssp xylosoxydans A-6 N-acyl-D -glutamate amidohydrolase; Alicaligenes faecalis-DA1: Alcaligenes faecalis DA1 ... purification of L -amino acid acylase and D -amino acid acylase from Pseudo-monas sp 1158 J Antibiotic 33, 550–555. 23 Wakayama, M., Yada, H., Kanda, S., Hayashi, S., Yatsuda, Y., Sakai, K & Moriguchi, ... in a process of N-D-AAase and N-acylamino acid racemase However, some N-D-AAases isolated from bacteria have some L-aminoacylase activity [18,33] Therefore, it is necessary to avoid -aminoacylase

Ngày tải lên: 08/03/2014, 16:20

... CCG ARA510 CGG TGA CAC AGG CTT ATC ATG ACT GG ARA514 TAATACGCATTTGCTC CGT GTT TTC GTC ATA AAA TAA AAC GCT TTC AAA TAC ARA515 GTATTTGAAAGCGTTTTATTTTATGACGAA AAC ACG GAG CAA ATG CGT ATT A Trang 6AraL ... strains Oligonucleotides ARA458 CTCAGCCAATTTGGTTACATCCTTGTCCAAGTCAATCAGAATGCCAGCCGGTGCCAC ARA459 GTGTCACCGGCTGGCATTCTGATTGACTTGGACAAGGATGTAACCAAATTGGCTGAG ARA509 CC AGT CAT GAT AAG CCT GTG TCA ... ATCGAAAACACGGAGCAAATGCGTATTATGGCCAGTCATGATACGCCTGTGTCACCGGCTGGCATTCTGATTGAC M pLG12/pLG13 pLG11 pLG5 rbs araA araB araD araM araN araP araQ abfA IQB832 A Fig 1 Schematic representation

Ngày tải lên: 14/03/2014, 23:20

... kineticparameters Km, Vmax and kcatwere determined for the purified AATB3 Values for Km and Vmax for both amino donors (l-aspartate and l-glutamate) and ac-ceptors (a-ketoglutarate and oxaloacetate) ... -aspartate was used as amino donor for a-ketoglutarate, and 30 m M L -gluta-mate was used as amino donor for oxaloacetate The activity of a-ketoglutarate was adjusted to 100. Trang 5analysis of the activities ... showed maximal activity at pH 8.0 and 45C, had relatively high activity over an alkaline pH range (pH 7.0–9.0) and was stable up to 50C AATB3 catalyzed the transamination of five amino acids,

Ngày tải lên: 14/03/2014, 23:20

... The bandwidth of each of the five phases is shown separately. Sprite LFS has a higher write bandwidth and the same read bandwidth as SunOS with the exception of sequen- tial reading of a file that ... Foundation under grant CCR-8900029, and in part by the National Aeronautics and Space Administration and the Defense Advanced Research Projects Agency under contract NAG2-591. This paper will appear ... log as the most up to date ‘‘truth’’ about the state of the data on disk. The main difference is that database systems do not use the log as the final repository for data: a separate data area is...

Ngày tải lên: 12/09/2012, 15:05