key elements of a pr plan

Tài liệu Elements of a PR Plan pptx

Tài liệu Elements of a PR Plan pptx

... addition to the traditional array of print and broadcast sources, for dissemination of news and information. Every organization should have a program to stay in touch regularly with appropriate ... transparencies. Press packages may include black-and-white photos and state that color material also is available via your Web site’s press section. Audio Tapes for Radio Audio tapes are rarely used, but can ... In addition to an ongoing public relations campaign it may be necessary to reach out to head off any negative publicity caused by lack of accurate information. Examples of appropriate use of...

Ngày tải lên: 23/12/2013, 00:15

15 441 1
Tài liệu Báo cáo khoa học: Spectroscopic characterization of a higher plant heme oxygenase isoform-1 from Glycine max (soybean) ) coordination structure of the heme complex and catabolism of heme docx

Tài liệu Báo cáo khoa học: Spectroscopic characterization of a higher plant heme oxygenase isoform-1 from Glycine max (soybean) ) coordination structure of the heme complex and catabolism of heme docx

... oxyheme appeared at 540 and 579 nm. Then, a broad band appeared at around 660 nm, and was maximal 9–12 min after initiation of the reaction. The spectral features of the final reaction mixture were analogous, ... the axial heme ligand in rat heme oxygenase-1. Arch Biochem Biophys 317, 253–258. 21 Chu GC, Katakura K, Tomita T, Zhang X, Sun D, Sato M, Sasahara M, Kayama T, Ikeda-Saito M & Yoshida T ... coli. Plant Physiol 97, 1495–1401. 40 Onda Y, Matsumura T, Kimara-Ariga Y, Sakakibara T, Sugiyama T & Hase T (2000) Differential interaction of maize root ferredoxin:NADP + oxidoreductase with photosynthetic...

Ngày tải lên: 19/02/2014, 05:20

16 618 0
A LIST OF SOME PR FUNCTIONS

A LIST OF SOME PR FUNCTIONS

... advance for management of the crisis and the primary goal of this strategy should be the protection of participants, spectators and participating institutions. Having a strategy set in advance ... to Key Audiences Communication tactics may include traditional channels, such as media (television, radio, newspapers and magazines) and Web sites, as well as non-media channels, such as grassroots ... organizations and interest groups are "battling" for space or airtime. Press Releases Press releases help inform media of team-related news and events and can serve as a summary prior...

Ngày tải lên: 17/10/2013, 12:15

6 367 0
Tài liệu How to Plan a PR Campaign docx

Tài liệu How to Plan a PR Campaign docx

... notch PR plan contain? What do the professionals include? This session takes you thr ough all the critical stages of planning a PR campaign: • The essential stages of planning a PR campaign – and what ... effectiveness of a PR campaign? Find out at How to Plan a PR Campaign. How to Plan a PR Campaign is an intensive two-day seminar designed to show communications professionals how to plan, implement and ... W rite a PR Plan What should a PR plan look like? What should it say? This session explains the practicalities of sitting down and writing a full-blown PR campaign: • How to write a PR plana step-by-step...

Ngày tải lên: 23/12/2013, 00:15

4 673 0
Tài liệu Issues Involved When Updating the Primary Key of a Parent Row pptx

Tài liệu Issues Involved When Updating the Primary Key of a Parent Row pptx

... DataTable. This is the default. None Indicates that no action takes place. SetDefault Indicates that the DataColumn values in the child DataTable are to be set to the value in the DefaultValue ... J6COM. A copy of this row is stored in a DataTable named customersDT. • There is a row in the Orders table that also has a CustomerID of J6COM. A copy of this row is stored in a DataTable named ... child table before you push the deletes to the parent table. Updating the Primary Key of a Parent Table and Pushing the Change to the Database In this section you'll learn what happens...

Ngày tải lên: 24/12/2013, 01:17

6 433 0
Tài liệu Báo cáo khoa học: C-Terminal extension of a plant cysteine protease modulates proteolytic activity through a partial inhibitory mechanism doc

Tài liệu Báo cáo khoa học: C-Terminal extension of a plant cysteine protease modulates proteolytic activity through a partial inhibitory mechanism doc

... aa 208 aa 24 aa BamH 34 aa Start Stop Xho1 N -Pro Protease domain Protease domain CT - ex 380 aa 1 II NP 114 aa 208 aa BamH1 34 aa Start Stop Xho1 SS SS G SSS S N-Pro 356 aa III MSTLFII S ILLFLAS F SYAMDI S TIEYKYDKSS AWRTDEEVKEIYELWLAKHDKVY SG LVEYEKRFEIFKDNLKFIDEH NSENHTYKMGLTPYTDLTNEEFQAIYLGTRSDTIHRLKRTINISERYAYEAGDNLPEQIDWRKKGAVTPVKNQGKCG SCWAFSTVSTVESINQIRTGNLISLSEQQLVDCNKKNHG CKGGAFVYAYQYIIDNGGIDTEANYPYKAVQGPCRAAK KVVRIDGYKGVPHCNENALKKAVASQPSVVAIDASSKQF QHYKSGIFSGPCGTKLNHGVVIVGYWKDYWIVRNSW GRYWGEQGYIRMKRVGGCGLCGIARLPYYPTKA AGDENSKLETPELLQWSEEAFPLA IV A B 66 ... rmErv-C +CT . Because Erv-C isolated from the latex of the same plant does not show the CT-extension, the possibility 19 aa 114 aa 208 aa 24 aa Pre N-Pro Protease domain CT - ex 365 aa H1 I N Pro CT ex 114 aa 208 ... Jiban K. Dattagupta and Sampa Biswas Crystallography and Molecular Biology Division, Saha Institute of Nuclear Physics, Kolkata, India Keywords C-terminal extension; cysteine proteases; modulation...

Ngày tải lên: 14/02/2014, 14:20

13 761 0
Tài liệu Báo cáo khoa học: Crystal structure of Klebsiella sp. ASR1 phytase suggests substrate binding to a preformed active site that meets the requirements of a plant rhizosphere enzyme doc

Tài liệu Báo cáo khoa học: Crystal structure of Klebsiella sp. ASR1 phytase suggests substrate binding to a preformed active site that meets the requirements of a plant rhizosphere enzyme doc

... QuikChange site-directed mutagenesis kit (Stratagene, La Jolla, CA, USA). Plasmid pET-1TK was used as template and Kleb(HtoA)fw (5¢-GCTTAGCCGCGCCGGCATTCG) and Kleb(HtoA)rv (5¢-CGAATGCCGGCGCGGCTAAGC) ... groups of HAPs are adapted to different habitats. To support plant growth, bacteria do not need to release phosphate as fast as the diges- tive tract of an animal host, where possible substrates might ... similarity, the overall structure of Klebsiella phytase bears similar- ity to other histidine-acid phosphatases, such as E. coli phytase, glucose- 1-phosphatase and human prostatic-acid phosphatase....

Ngày tải lên: 16/02/2014, 09:20

13 766 0
Tài liệu THE ELEMENTS OF BACTERIOLOGICAL TECHNIQUE A LABORATORY GUIDE FOR MEDICAL, DENTAL, AND TECHNICAL STUDENTS pptx

Tài liệu THE ELEMENTS OF BACTERIOLOGICAL TECHNIQUE A LABORATORY GUIDE FOR MEDICAL, DENTAL, AND TECHNICAL STUDENTS pptx

... at the far corner of the table top is invaluable in the preparation of tubular apparatus with sharp curves, and for coating newly-made glass apparatus with a layer of soot to prevent too rapid ... how to fit up and adapt apparatus for his daily work, and how to carry out thoroughly and systematically the various bacterioscopical analyses that are daily demanded of the bacteriologist ... been prepared especially for this volume; for a picture, if good, possesses a higher educational value and conveys a more accurate impression than a page of print; and even sketches of apparatus...

Ngày tải lên: 16/02/2014, 22:20

666 513 0
Tài liệu Báo cáo khoa học: Structural insights into the substrate specificity and activity of ervatamins, the papain-like cysteine proteases from a tropical plant, Ervatamia coronaria ppt

Tài liệu Báo cáo khoa học: Structural insights into the substrate specificity and activity of ervatamins, the papain-like cysteine proteases from a tropical plant, Ervatamia coronaria ppt

... substrate specificity and activity of ervatamins, the papain-like cysteine proteases from a tropical plant, Ervatamia coronaria Raka Ghosh, Sibani Chakraborty, Chandana Chakrabarti, Jiban Kanti Dattagupta ... acid at a particular position for this family of plant cysteine pro- teases. The primers used were 5¢-TTGCCTGAGCA TGTT GATTGGAGAGCGA AAG-3 ¢ (forward) and 5¢-GGGAT AATAAGGTAATCTAGTGATTCCAC-3¢ ... S, Sundd M, Jagan- nadham MV & Dattagupta JK (1999) Crystallization and preliminary X-ray analysis of ervatamin B and C, two thiol proteases from Ervatamia coronaria. Acta Crystallogr D 55,...

Ngày tải lên: 18/02/2014, 16:20

14 636 0
Tài liệu Enhancement of aesthetic treatment planning and communication using a diagnostic mock-up pptx

Tài liệu Enhancement of aesthetic treatment planning and communication using a diagnostic mock-up pptx

... cases. The diagnostic wax-up often reveals additional necessary treatment that was not evident during the clinical exam and is a dynamic visual and functional aid in achieving predictable results. ... first patient visit, impressions are taken to create a diagnostic wax-up. A silicone impression is made from the diagnostic wax-up using a polyvinyl siloxane putty material to create a matrix. At ... diag- nostic mock-up is a fairly simple and fast pro - cedure that can enhance the satisfaction of both patient and dentist significantly._ Editorial note: A complete list of references is available from...

Ngày tải lên: 19/02/2014, 17:20

5 379 0
Tài liệu Báo cáo khoa học: Local stability identification and the role of a key aromatic amino acid residue in staphylococcal nuclease refolding pdf

Tài liệu Báo cáo khoa học: Local stability identification and the role of a key aromatic amino acid residue in staphylococcal nuclease refolding pdf

... (> 99%) was obtained from Panreac (Barcelona, Spain). Urea was a product of Acros (Pittsburgh, PA, USA). The Quick- change TM kit containing Pfu DNA polymerase, 10 · reac- tion buffer and DpnI ... Institute of Physics, Academia Sinica, Taipei, Taiwan, ROC 3 Department of Biochemistry, University of Minnesota College of Biological Sciences, St Paul, MN, USA Staphylococcal nuclease (SNase) is a ... initiation sites of staphylococcal nuclease: a study of N-terminal short fragments. Bio- polymers 75, 229–241. 26 Hirano S, Kamikubo H, Yamazaki Y & Kataoka M (2005) Elucidation of information...

Ngày tải lên: 20/02/2014, 01:20

7 556 0
Tài liệu Báo cáo khoa học: Mutational analysis of plasminogen activator inhibitor-1 Interactions of a-helix F and its neighbouring structural elements regulates the activity and the rate of latency transition pdf

Tài liệu Báo cáo khoa học: Mutational analysis of plasminogen activator inhibitor-1 Interactions of a-helix F and its neighbouring structural elements regulates the activity and the rate of latency transition pdf

... the amount of PAI-1 required to inhibit half the uPA. The half-life of PAI-1 was finally calculated from an exponential decay plot of the data obtained. Generally, only one preparation of each PAI-1 ... an A increased the rate of latency transition more than twofold. Three variants, I13 7A, V14 2A, and N15 2A, had a biphasic loss of activity, one component with a significantly faster latency transition ... behaving as a substrate for uPA decreased approximately twofold for PAI-1(V12 6A) , PAI-1(F10 0A) , PAI-1(F12 8A) and PAI-1(W14 1A) with a concomitant increase in the fraction being inert to uPA. Substrate behaviour...

Ngày tải lên: 20/02/2014, 11:20

9 607 0
The impact of a cancer Survivorship Care Plan on gynecological cancer patient and health car provider reported outcomes (ROGY Care): study protocol for a pragmatic cluster randomized controlled trial potx

The impact of a cancer Survivorship Care Plan on gynecological cancer patient and health car provider reported outcomes (ROGY Care): study protocol for a pragmatic cluster randomized controlled trial potx

... status, and clinical variables such as cancer stage at diagnosis, time after diagnosis, and initial treat- ment. All measures will be collected at the beginning of the trial, and at 6, 12, 18 and ... Providing information that i s congruent with a patient ’sneedsat that particular time is an important determinant for patient satisfaction and affects health-related quality of life (HRQoL) and anxiety and ... sum- marize characteristics of both hospitals and patients. Characteristics of patients (i.e ., age, type of cancer, stage, treatment, so cio-economic status, marital statu s, educational level,...

Ngày tải lên: 05/03/2014, 15:20

8 792 0
Báo cáo khoa học: Nup358, a nucleoporin, functions as a key determinant of the nuclear pore complex structure remodeling during skeletal myogenesis docx

Báo cáo khoa học: Nup358, a nucleoporin, functions as a key determinant of the nuclear pore complex structure remodeling during skeletal myogenesis docx

... and 5¢-AUAAGUAAUUUCUACGACG dTdT-3¢; Nup358, 5¢-CCAGUCACUUACAAUUAAAd TdT-3¢ and 5¢-UUUAAUUGUAAGUGACUGGdTdT-3¢ (siNup358-1), 5¢-UGAAGCACAUGCUAUAAAAdTdT-3¢ and 5¢-UUUUAUAGCAUGUGCUUCAdTdT-3¢ (siNup- 358-2)]. ... 5¢-AGCTTATCCTCGTTACAATCAA GAGTAAGTCTCTCAAGCGGTGGTAGCTGAAGAGG A- 3¢) were annealed and inserted into the BglII and HindIII sites of pEGFP-NLS. The oligonucleotide fragment for NES-NLS was flanked ... J & Kouzarides T (2001) Differential localization of HDAC4 orchestrates muscle differentiation. Nucleic Acids Res 29, 3439–3447. 22 Yasuhara N, Shibazaki N, Tanaka S, Nagai M, Kamik- awa Y,...

Ngày tải lên: 06/03/2014, 01:20

12 459 0
w