1 hypnosis is a trance state

Tài liệu Báo cáo khoa học: The Arabidopsis protein kinase Pto-interacting 1-4 is a common target of the oxidative signal-inducible 1 and mitogen-activated protein kinases docx

Tài liệu Báo cáo khoa học: The Arabidopsis protein kinase Pto-interacting 1-4 is a common target of the oxidative signal-inducible 1 and mitogen-activated protein kinases docx

... GCTCAGTGGTGGA-3 and 5-CTGAGGGAAGCAAG AATGGA-3, OXI1 (At3g25250): 5-GACGAGATTATC AGATTTTACGC-3 and 5-AACTGGTGAAGCGGAAG AGAC-3, PTI1-4 (At2g47060): 5-CCCCAAAGAAAATG AGTTGCT-3 and 5-GCATCATTTCCTGGAGGAAAG-3 ... Journal 278 (2 011 ) 11 26 11 36 ª 2 011 The Authors Journal compilation ª 2 011 FEBS C Forzani et al PTI1-4, a common target of OXI1 and MAPKs HA-OXI1 HA-OXI1 Col-0 PTI1-4-Myc Col-0 PTI1-4-Myc HA Input ... suggest FEBS Journal 278 (2 011 ) 11 26 11 36 ª 2 011 The Authors Journal compilation ª 2 011 FEBS 11 29 PTI1-4, a common target of OXI1 and MAPKs A C Forzani et al HIS-OXI > HIS: A OXI PTI OXI OXIK45R...

Ngày tải lên: 14/02/2014, 19:20

11 701 0
Báo cáo Y học: ik3-1/Cables is a substrate for cyclin-dependent kinase 3 (cdk 3) pdf

Báo cáo Y học: ik3-1/Cables is a substrate for cyclin-dependent kinase 3 (cdk 3) pdf

... previously [11 ] To replace Ser274 in ik3 -1 cDNA with Thr or Ala, mutagenic primers, 50 -TCTCCGGAGATGTCGAACACT CTCAGGTACTCCCAGACCA-30 or 50 -TCTCCGGAGAT GTCGAACACTCTCAGGTGCTCCCAGACCA-30 (corresponding ... The same residue is also phosphorylated by both cdk3/cyclin A and cdk3/E in vivo (Fig 5) Analysis of ik3 -1 amino-acid sequence indicates that ik3 -1 has a putative ZRXL (Z and X are typically basic) ... A and dn indicate cyclin E, cyclin A and a dominant-negative form of cdk anti-FLAG Ig, we obtained a larger amount of 32P-labeled FLAG –p70ik3 -1 from these cells (Fig 3A, lane of the upper panel)...

Ngày tải lên: 24/03/2014, 04:21

7 308 0
The small GTPASE   ARF like protein 1 (ARL1) is a new regulator of golgi structure and function

The small GTPASE ARF like protein 1 (ARL1) is a new regulator of golgi structure and function

... ClassII: ARF4, ARF5 Rab ARF Arl Arl1, Arl2, Arl3, Arl4, Arl5, Arl6, Arl7, ARFRP1, ARD1 ClassIII: ARF6 Fig Classification of mammalian ARF famlily small GTPases Ran Sar Sar 1a, Sar1b Fig A schematic ... ARF1 1. 3.2 Arl1 1. 3.3 Arl2 1. 3.4 Arl3 1. 3.5 Arl4 1. 3.6 Arl4L 1. 3.7 Arl5 1. 3.8 Arl6 1. 3.9 Arl7 1. 3 .10 Arl8 1. 3 .11 ARFRP1 1. 3 .12 ARD1 1. 4 Rationale of this Study iv Chapter 2 .1 Materials and Methods ... members at the moment 12 13 human ARF1 human ARF mouse ARF2 mouse ARF2 human ARF3 human ARF3 human ARF4 human ARF4 human ARF5 human ARF5 human ARF6 human ARF6 rat Arl1 rat Arl1 human Arl5 human Arl5...

Ngày tải lên: 17/09/2015, 17:20

184 303 0
What is a Steady State Economy

What is a Steady State Economy

... Economic Analysis 19 61 500 19 67 19 73 19 79 19 85 Year 19 91 1997 2003 Global Ecological Overshoot The World  Global ecological footprint is greater than available biocapacity!  We are in a state of ... natural and human-built capital 18 Characteristics of a SSE  Sustainable Scale  Sustainable Scale  Fair Distribution  Fair Distribution  Efficient Allocation  Efficient Allocation  High Quality ... What is a Steady State Economy (SSE) ?  Stable population  Stable per capita consumption  Energy and material flows are reduced and kept within ecological limits  Constant stocks of natural...

Ngày tải lên: 23/06/2016, 14:59

32 313 0
Learning english is a piece of cake 1

Learning english is a piece of cake 1

... think English is difficult and it’s hard to memorize new words ðeɪ θɪŋk ˈɪŋ ɡlɪʃ ɪz ˈdɪfɪk əlt ænd ɪts hɑːrd tə ˈmem ə raɪz njuː wɜːdz and grammatical rules In fact, learning English can be a piece ...  In fact, she is a sales person! “Improve” = cải thiện, cải tiến I want to improve my English! Many people are worried about learning English ˈmen i ˈpiːpl ɑːr ˈwʌrid ə ˈbaʊt ˈlɝːn ɪŋ ... ˈeɪʃ ən doʊnt ˈ wɝːɪ ə ˈbaʊt ˈɡræm ə Don’t be afraid of making mistakes Just try to speak doʊnt biː ə ˈfreɪd ʌv ˈmeɪk ɪŋ mɪ ˈsteɪk dʒʌst traɪ tuː spiːk Speak English as much as possible spiːk ˈɪŋ...

Ngày tải lên: 27/01/2014, 20:11

2 1,7K 15
Tài liệu Báo cáo Y học: The b-1,4-endogalactanase A gene from Aspergillus niger is specifically induced on arabinose and galacturonic acid and plays an important role in the degradation of pectic hairy regions pdf

Tài liệu Báo cáo Y học: The b-1,4-endogalactanase A gene from Aspergillus niger is specifically induced on arabinose and galacturonic acid and plays an important role in the degradation of pectic hairy regions pdf

... whether a small amount of a- L -1, 3-arabinofuranosidase was responsible for the disappearance of Fig HPAEC analysis of the hydrolysis of arabinogalactans by GALA Three different arabinogalactans were ... while soy arabinogalactan consists of 57% D-galactose and 38% L-arabinose Methylation analysis demonstrated that a substantial amount of the L-arabinose residues (14 %) in soy arabinogalactan is present ... in Materials and methods Purification and characterization of GALA Hydrolysis of arabinogalactans To obtain an A niger transformant that produces increased levels of b -1, 4-endogalactanase, a construct...

Ngày tải lên: 21/02/2014, 01:21

9 669 0
Báo cáo khoa học: SAF-3, a novel splice variant of the SAF-1/MAZ/Pur-1 family, is expressed during inflammation pptx

Báo cáo khoa học: SAF-3, a novel splice variant of the SAF-1/MAZ/Pur-1 family, is expressed during inflammation pptx

... splice acceptor 1A 75 ATCTTCCAGgtaacaac 625 cacctcagGGTCACGCC 1C 87 CCATTCCAGgtgagtag 84 ctccgcagGCCGCGCCG 8 51 CTTCTCCCGgtgtgcac 403 gtccccagGCCGGATCA 64 AATGTGAGgtaggaag 277 ctcctcagAAATGTGAG 17 2 ... cells SAF-3 antibody was prepared against the N-terminal epitope (MDPSNWSSFIFQ peptide) that is absent in the SAF -1 and SAF-2 isoforms Ray A & Ray BK (19 98) Isolation and functional characterization ... 35S-labeled The control reaction contained no plasmid DNA The reaction products were fractionated by 11 % SDS–PAGE and visualized by autoradiography Western blot analysis pcDNA3-His, pcDSAF -1 and...

Ngày tải lên: 07/03/2014, 02:20

11 440 0
Báo cáo khoa học: Ki-1⁄57 interacts with PRMT1 and is a substrate for arginine methylation pptx

Báo cáo khoa học: Ki-1⁄57 interacts with PRMT1 and is a substrate for arginine methylation pptx

... 279, 11 444 11 455 12 Ozaki T, Watanabe K-I, Nakagawa T, Miyazaki K, Takahashi M & Nakagawara A (2003) Function of p73, FEBS Journal 273 (2006) 3946–39 61 ª 2006 The Authors Journal compilation ... phosphorylation Yeast two–hybrid screenings and interaction analysis pBTM 116 -Ki -1 ⁄ 57 (12 2– 413 ) [11 ], pBTM 116 -Ki -1 ⁄ 57 (1 15 0) and pBTM 116 -PRMT1 (1 344) vectors were used to express fragments spanning ... 847–855 11 Nery FC, Passos DO, Garcia VS & Kobarg J (2004) Ki1 ⁄ 57 interacts with RACK1 and is a substrate for the phosphorylation by phorbol 12 -myristate 13 -acetate activated protein kinase C...

Ngày tải lên: 16/03/2014, 13:20

16 368 0
Báo cáo khoa học: Syndecan-4 is a signaling molecule for stromal cell-derived factor-1 (SDF-1)/ CXCL12 pptx

Báo cáo khoa học: Syndecan-4 is a signaling molecule for stromal cell-derived factor-1 (SDF-1)/ CXCL12 pptx

... RNA) SD -1 (SD-4 ds RNA) IgGl (mocktransfected) 0 10 10 1 10 2 10 3 10 0 SD -1 (mocktransfected) 10 1 10 2 10 3 10 4 E D 32 0 10 10 1 10 2 10 3 10 4 Fig SD-4 is involved in SDF -1 activation of MAPK pathways ... molecular mass distribution on SDS ⁄ PAGE Using the respective specific Abs, glycanated PGs migrate as follows: SD-4 as a 10 0–250 kDa broad smear, SD -1 as a single 98 kDa band, CD44 as a 11 0 kDa band, ... Glycan and glycosaminoglycan binding properties of stromal cell-derived factor (SDF) -1alpha Glycobiology 10 , 21 29 34 Valenzuela-Fernandez A, Palanche T, Amara A, Magerus A, Altmeyer R, Delaunay...

Ngày tải lên: 16/03/2014, 18:20

15 423 0
Báo cáo khoa học: C-terminal truncated cannabinoid receptor 1 coexpressed with G protein trimer in Sf9 cells exists in a precoupled state and shows constitutive activity ppt

Báo cáo khoa học: C-terminal truncated cannabinoid receptor 1 coexpressed with G protein trimer in Sf9 cells exists in a precoupled state and shows constitutive activity ppt

... exist in an RGGDP CB1 CB1( 417 ) 50 40 35 40 30 pmol/mg pmol/mg 25 20 15 10 30 20 10 0 0.5x104 1x104 1. 5x104 2.0x104 2.5x104 [SR 14 1 716 A] 0.2x104 0.6x104 1. 0x104 1. 4x104 [SR 14 1 716 A] Fig Saturation ... 17 –22 Rinaldi-Carmona M, Barth F, Heaulme M, Shire D, Calandra B, Congy C, Martinez S, Maruani J, Neliat G & Caput D (19 94) SR1 417 1 6A, a potent and selective antagonist of the brain cannabinoid ... receptor-mediated signal transduction Nature 14 2, 12 09 12 18 18 Bouaboula M, Perrachon S, Milligan L, Canat X, Rinaldi-Carmona M, Portier M, Barth F, Calandra B, Pecceu F, Lupker J, et al (19 97) A selective...

Ngày tải lên: 23/03/2014, 07:20

10 315 0
Báo cáo khoa học: Alpha 1-antichymotrypsin/SerpinA3 is a novel target of orphan nuclear receptor Nur77 potx

Báo cáo khoa học: Alpha 1-antichymotrypsin/SerpinA3 is a novel target of orphan nuclear receptor Nur77 potx

... primers harboring the mutations, 5¢-CTAATCTCTT CCTCCAAAAAGCACACAGA-3¢ for St -18 2 and St-93/ -18 2, 5¢-AGAAATTATCATCTTTTCCAGTCCGAGA-3¢ for St-93 and St-93/ -18 2, and 5¢-TGGTCTTGAACTCCT CGTGATCTGCCCA-3¢ ... 5¢-ATGGTGGGAATGGGTCAGAAG-3¢ and 5¢-CA CGCAGCTCATTGTAGAAGG-3¢ Another primer pair used for SerpinA3 was ACTas5-ACTas3: 5¢-GAATCC ACCAGCTACATCCA-3¢ and 5¢-GTGCCCTCCTCAAA TACATCA-3¢ Western blot assay The cells were ... pair for SerpinA3 was ACT5-ACT3: 5¢-GACTCGCAGACAATGATGG TC-3¢ and 5¢-GCAAACTCATCATGGGCACC-3¢ The results were normalized with b-actin, for which the primers were 5¢-ATGGTGGGAATGGGTCAGAAG-3¢ and...

Ngày tải lên: 23/03/2014, 07:20

14 398 0
Báo cáo khoa học: Total chemical synthesis and NMR characterization of the glycopeptide tx5a, a heavily post-translationally modified conotoxin, reveals that the glycan structure is a-D-Gal-(1fi3)-a-D-GalNAc pot

Báo cáo khoa học: Total chemical synthesis and NMR characterization of the glycopeptide tx5a, a heavily post-translationally modified conotoxin, reveals that the glycan structure is a-D-Gal-(1fi3)-a-D-GalNAc pot

... GalNAc:H1 GalNAc:CH3 GalNAc:H3 GalNAc:H1 Gal:H2 Gal:H2 4.79 1. 79 3.77 4.79 3.53 3.53 10 ThrcCH3 12 AlaaH 10 ThrcCH3 10 ThrbH 11 AlaßCH3 12 AlaaH 0.98 4.07 0.98 4.04 1. 09 4.07 anomeric proton of Gal, ... in Figs and Chemical shift (p.p.m.) Proton (1H) Chemical shift (p.p.m.) Disaccharide: Gal-GalNAc Proton (1H) GalNAc:H1 GalNAc:H3 GalNAc:H3 Gal:H1 Gal:H1 Gal:H2 GalNAc:CH3 GalNAc:CH3 GalNAc:CH3 ... residues Thr10 and Ala12 and the carbohydrate moieties of GalNAc (GN) and Gal (G) The individual amino acids Thr10, Ala12 are represented by 10 T and 12 A, respectively, while GNH1 and GNH3 represents...

Ngày tải lên: 23/03/2014, 13:20

11 566 0
Báo cáo khoa học: A steady-state competition model describes the modulating effects of thrombomodulin on thrombin inhibition by plasminogen activator inhibitor-1 in the absence and presence of vitronectin ppt

Báo cáo khoa học: A steady-state competition model describes the modulating effects of thrombomodulin on thrombin inhibition by plasminogen activator inhibitor-1 in the absence and presence of vitronectin ppt

... from Sigma (St Louis, MO, USA) Polysorbate-20 (Surfactant P20), and all additional BIAcore materials were obtained from BIAcore AB (Uppsala, Sweden) Proteins Ovalbumin (grade V) was obtained from ... PAI -1 The poor rate of inhibition of thrombin by PAI -1 alone (ki  10 3 M )1 s )1) can be substantially increased by the cofactor VN [3] Complexed to VN, PAI -1 inhibits thrombin at a rate that is ... nM) [2 ,11 ] Thus, the minor effect of TM on the thrombin-VR1tPA–PAI -1 interaction appears to Fig TM does not alter the distribution of the cleavage and substrate pathway Analysis by SDS/PAGE of...

Ngày tải lên: 23/03/2014, 17:21

10 486 0
Báo cáo khoa học: Ets-1/ Elk-1 is a critical mediator of dipeptidyl-peptidase III transcription in human glioblastoma cells pdf

Báo cáo khoa học: Ets-1/ Elk-1 is a critical mediator of dipeptidyl-peptidase III transcription in human glioblastoma cells pdf

... using primers b-actin F (sense) (5¢-AGAAAATCTGGC ACCACACC-3¢) and b-actin R (antisense) (5¢-TAGCACAGCCTGGATAGCAA-3¢), and served as the internal control Melting-curve analysis was performed to ... acetyl-lleucyl-l-argininal, inhibitor of dipeptidyl aminopeptidase III by bacteria J Antibiot (Tokyo) 37, 680–6 81 Hazato T, Inagaki-Shimamura M, Katayama T & Yamamoto T (19 82) Separation and characterization of a ... 5¢-CCCCTCGAGCCGTC CAGACCTGTAAAAG-3¢ ()7 81 ⁄ +5; pAAS-2), DPP-III F-490: 5¢-CACCTCGAGCTTTGCAACTTCCAAG-3¢ ()485 ⁄ +5; pAAS-3), DPP-III F -12 9: 5¢-CGACTCGAGAAG CTCGTCTTGG-3¢ ( )12 4 ⁄ +5; pAAS-5), DPP-III...

Ngày tải lên: 29/03/2014, 09:20

15 328 0
Báo cáo khoa học: A novel glycogen-targeting subunit of protein phosphatase 1 that is regulated by insulin and shows differential tissue distribution in humans and rodents pdf

Báo cáo khoa học: A novel glycogen-targeting subunit of protein phosphatase 1 that is regulated by insulin and shows differential tissue distribution in humans and rodents pdf

... QLQRDALRHFAPCPPRARGLQEARVALEPALEPGFAARLQAQRICLERADAGPLGVAGS RAT R3E 11 9 QLQRDALRHFAPCPPRTRGLQDARIALEPALEPGFAARLQAQRICLERADAGPLGVAGS HUMAN R3E 11 9 QLQRDALRHFAPCQPRARGLQEARAALEPASEPGFAARLLTQRICLERAEAGPLGVAGS PP1 binding ... TGA gacgaggcgcctgcggccgacggcggaaaacaccaaaggcacccgggggcggggcgacccgatgtggcggggaggagtag 920 I H F I * 279 9 21 gagagaccaggattggcgggagcggtccaagggagtc 957 Fig (A) Diagram of human PPP1R3E mRNA compared ... ARVLDLAYEKRVSVRWSADGWRSLRESPASYAGPAPSPPRADRFAFRLPAPPVGGTLLF RAT R3E 17 8 ARVLDLAYEKRVSVRWSADGWRSLRESPASYAGPAPAPPRADRFAFRLPAPPVGGALLF HUMAN R3E 17 8 ARVVDLAYEKRVSVRWSADGWRSQREAPAAYAGPAPPPPRADRFAFRLPAPPIGGALLF GM/ RGL/R3A...

Ngày tải lên: 30/03/2014, 16:20

12 387 0
microsomal epoxide hydrolase gene is a novel endogenous protectant against beta amyloid (1-42)-induced cognitive impairments in mice

microsomal epoxide hydrolase gene is a novel endogenous protectant against beta amyloid (1-42)-induced cognitive impairments in mice

... wide at the bottom and 10 cm wide at the top The arms converged at an equilateral triangular central area that was cm at its longest axis Each mouse was placed at the end of one arm and allowed ... Japanese journal of pharmacology 19 97;73 (1) : 51- 57 Nitta, A. ; Itoh, A. ; Hasegawa, T.; Nabeshima, T [beta]-Amyloid proteininduced Alzheimer's disease animal model Neuroscience Letters 19 94 ;17 0 (1) :6366 ... Nucleus Basalis Neurons against [beta]-Amyloid Neurotoxicity Neurobiology of Disease 19 99;6(2) :10 912 1 Harlow, E.; Lan, D Using antibodies: A laboratory Manual Cold Spring, Harbor Laboratory Press,...

Ngày tải lên: 12/06/2014, 15:50

54 170 0
Báo cáo hóa học: " MMP-1 is a (pre-)invasive factor in Barrettassociated esophageal adenocarcinomas and is associated with positive lymph node status" doc

Báo cáo hóa học: " MMP-1 is a (pre-)invasive factor in Barrettassociated esophageal adenocarcinomas and is associated with positive lymph node status" doc

... 20 01, 19 (4) :11 18 -11 27 40 Inoue T, Yashiro M, Nishimura S, Maeda K, Sawada T, Ogawa Y, Sowa M, Chung KH: Matrix metalloproteinase -1 expression is a prognostic factor for patients with advanced gastric ... cells based on alpha(2)beta (1) -integrin expression J Cell Sci 20 01, 11 4(Pt 21) :3865-3872 Tanioka Y, Yoshida T, Yagawa T, Saiki Y, Takeo S, Harada T, Okazawa T, Yanai H, Okita K: Matrix metalloproteinase-7 ... Muller-Hermelink HK, Marx A: NCAM(CD56) and RUNX1(AML1) are up-regulated in human ischemic cardiomyopathy and a rat model of chronic cardiac ischemia Am J Pathol 2003, 16 3(3) :10 81- 1090 Grimm M, Gasser M,...

Ngày tải lên: 18/06/2014, 16:20

11 648 0
Báo cáo hóa học: " Sargassum fusiforme fraction is a potent and specific inhibitor of HIV-1 fusion and reverse transcriptase" pot

Báo cáo hóa học: " Sargassum fusiforme fraction is a potent and specific inhibitor of HIV-1 fusion and reverse transcriptase" pot

... macrophages, microglia, and astrocytes by Sargassum fusiforme AIDS Res Ther 2006, 3 :15 Hoshino T, Hayashi T, Hayashi K, Hamada J, Lee JB, Sankawa U: An antivirally active sulfated polysaccharide ... was calculated comparative to assay performed in absence of treatment, 10 0% RT activity Data are mean ± SD of three separate experiments µg, inhibited HIV -1 RT activity in a dose dependent manner ... Cells 1G5 [11 ], SupT1 [12 ], and GHOST X4/R5 [13 ] cells were obtained from the HIV AIDS Research and Reference Reagent Program, Division of AIDS, NIAID, NIH, and were cultured and maintained as specified...

Ngày tải lên: 20/06/2014, 01:20

9 442 0
w