... mm ) 2, 2476 2, 2476 2, 2476 2, 2476 2, 2476 2, 2476 CK ( mm ) 5,5631 7,6778 7,6778 5,5631 8,7148 87,148 B ( mm ) 5,5631 5,5631 5,5631 5,5631 5,5631 5,5631 K 22 16,31 72 16,31 72 22 14,4 620 14,4 620 K ... 15,919 15,967 16,003 16, 027 Răng 17 18 19 20 21 22 23 24 Đờng kính 16, 027 16, 027 16, 027 16, 027 16, 027 16, 027 16, 027 F Kiểm tra sức bền dao truốt : Sơ đồ chịu lực : cắt dao chịu lực thành phần ... 16,7734 13, 621 7 13, 621 7 Q ( mm ) 10,8 928 10,8 928 10,8 928 10,8 928 10,8 928 10,8 928 K+K 33 36,6157 36,6157 33 38,6481 38,6481 RK ( mm ) 20 18 ,26 28 18 ,26 28 20 17,4414 17,4414 Phần phụ profin dụng cụ...
Ngày tải lên: 31/10/2012, 15:39
... 19 20 21 22 23 24 25 26 27 28 29 Structure of B 12- dependent glycerol dehydratase (Eur J Biochem 26 9) 4493 coenzyme B 12: X-ray structure of diol dehydratase-adeninylpentylcobalamin complex Structure ... (fold) 12 400 11 500 10 500 8760 7780 823 376 185 141 119 15.1 30.6 56.8 62. 1 65.4 100 93 85 71 63 2. 0 3.8 4.1 4.3 46 000 24 100 9770 8450 1 920 23 4 105 70.6 24 .0 100 93 120 100 52 21 18 4 .2 3.9 ... n ¼ 11–14 (R)-Propane-1 ,2- diol (S)-Propane-1 ,2- diol 0.40 ± 0.09 (604 ± 32) d 0 .27 ± 0.10 (24 4 ± 23 )d 4490 M Yamanishi et al (Eur J Biochem 26 9) Ó FEBS 20 02 Fig Structure of glycerol dehydratase...
Ngày tải lên: 21/02/2014, 03:20
Báo cáo khoa học: Solution structure of 2¢,5¢ d(G4C4) Relevance to topological restrictions and nature’s choice of phosphodiester links docx
... H5 G1 G2 G3 G4 C5 C6 C7 C8 5.18 4.7 4.91 4.61 4. 62 4.5 4.66 4 .26 2. 53 2. 45 2. 56 2. 48 2. 44 2. 31 2. 49 1.84 2. 37 2. 31 2. 48 2. 38 – – 2. 31 1. 82 3.88,3.69 4.18,4.08 4.51,4.14 – 4.39,4.07 4.10 4 .27 4.39,4.0 ... structure (AFI) of the iso d(GGGGCCCC )2 duplex Residue a (P-O5¢) b (O5¢-C5) c (C4¢-C5¢) n (C2¢-O2¢) f (P-O2¢) v (C1¢-N) P G1 G2 G3 G4 C5 C6 C7 C8 – )50 )31 )45 )68 )25 )28 )44 – 29 46 36 32 27 ... properties of 2 ,5¢ nucleic acids and their complexes with RNA and DNA Biophys Chem 95, 25 3 27 2 46 Eschenmoser, A (1999) Chemical etiology of nucleic acid structure Science 28 4, 21 18 21 24 47 Lu,...
Ngày tải lên: 16/03/2014, 18:20
Báo cáo khoa học: A unique tetrameric structure of deer plasma haptoglobin – an evolutionary advantage in the Hp 2-2 phenotype with homogeneous structure pot
... Huang HY, Liu HC & Mao SJT (20 04) Antioxidant role of human haptoglobin Proteomics 4, 22 21 22 28 Lai IH, Tsai TI, Lin HH, Lai WY & Mao SJT (20 07) Cloning and expression of human haptoglobin subunits ... 309–314 22 Tseng CF, Huang HY, Yang YT & Mao SJT (20 04) Purification of human haptoglobin 1-1, 2- 1, and 2- 2 using monoclonal antibody affinity chromatography Protein Express Purif 33, 26 5 27 3 23 Yueh ... Nature 196, 23 2 23 6 FEBS Journal 27 5 (20 08) 981–993 ª 20 08 The Authors Journal compilation ª 20 08 FEBS I H Lai et al 30 Forsyth IA & Wallis M (20 02) Growth hormone and prolactin-molecular and functional...
Ngày tải lên: 23/03/2014, 07:20
2 structure of presentation updated
... Điều cu i sống 19 Sự ý người nghe (§é chó ý) Cao ThÊp §Çu buæi Cu i buæi 20 (thêi gian) A.B.C Always Be Closing 21 thời điểm quan trọng Trước thuyết trình Giờ giải lao Sau thuyết trình 22 ... phần 23 Quy tắc 3T Trình bày khái quát trình bày Trình bày cần trình bày Trình bày tóm tắt trình bày 24 Người thuyết trình Người viết kịch Đạo diễn Diễn viên Huấn luyện viên 25 bí ... Huấn luyện viên 25 bí thành công Thứ nhất: Tập Thứ nhì: Tập Thứ ba: Tập 26 Học ăn, học nói, học gói, học mở 27 ...
Ngày tải lên: 03/04/2014, 21:16
nghiên cứu ảnh hưởng của trơn làm nguội tối thiểu đến lực cắt, mòn của dụng cụ cắt, chất lượng bề mặt gia công khi phay gang cầu bằng dao phay mặt đầu
... TRONG PHAY GANG CẦU BẰNG DAO PHAY MẶT ĐẦU 2. 1 Ảnh hƣởng dung dịch trơn nguội đến trình phay gang 28 cầu 2. 2 Ảnh hƣởng vị trí, số lƣợng vòi, góc bố trí vòi dẫn dung dịch 28 vào vùng cắt phay dao phay ... ĐHTN 23 http://www.lrc-tnu.edu.vn Luận văn Thạc sĩ Chuyên ngành công nghệ CTM 2. 1 Phun dung dịch vào mặt trƣớc dao 29 2. 2 Phun dung dịch vào mặt sau dao 29 2. 3 Phun mặt trƣớc mặt sau dao 29 2. 4 ... dòng khí 4KG/cm2, 5KG/cm2, 6KG/cm2 Quan hệ thời gian cắt (phút) giá trị nhám Ra 37 3 .23 trƣơng hợp cắt khô; cắt có sử dụng MQL với áp suất dòng khí 4KG/cm2, 5KG/cm2, 6KG/cm2 52 Quan hệ thời gian...
Ngày tải lên: 05/10/2014, 02:32
ứng dụng mô hình hóa bề mặt offset khi gia công bề mặt trên máy công cụ cnc bằng dao phay đầu cầu
... 23 Hình 2. 2 Mô hình hình học phần cầu dao 41 24 Hình 2. 3 Mối quan hệ thông số hình học dao 43 25 Hình 2. 4 Đồ thị hàm F1 44 26 Hình 2. 5 Mô hình bề mặt chi tiết gia công vị trí cắt 45 27 Hình 2. 6 ... hình học dao phay đầu cầu 22 Mô hình lực cắt 26 1 .2. 1 Xác định tƣơng tác dụng cụ cắt 26 1 .2. 2 Hiện tƣợng đảo dao 1 .2 29 1.3 Một số đặc điểm bề mặt chi tiết sau gia công 32 1.4 Kết luận 36 -3Số hóa ... thông số kết cấu dụng cụ 34 20 Hình 1 .20 Độ nhấp nhô bề mặt chi tiết 34 21 Hình 1 .21 Sự hình thành bề mặt gia công dao phay cầu 35 22 Hình 2. 1 Các thông số hình học trình phay 40 -6Số hóa Trung tâm...
Ngày tải lên: 05/10/2014, 18:56
STRUCTURE OF THE NEW TOEIC TEST (PART 2 - QUESTION - RESPONSE)
... time/color/what kind of E.g: 2pm sharp (đúng 2h), red… What should I do….? E.g: Take it to the police station… Object of transitive verbs: E.g: a notebook… What you think of What’s your opinion…? ... Go to + place / to + place: E.g: Go to the 2nd floor… Adverbial phrases of place: E.g: It’s next to the Post Office… Answers with no direct references of place: E.g: Tom already took it yesterday… ... Photographs Sentence Completion 40 15 -20 mins READING Text Completion 12 495 6-10 mins Reading 48 Comprehension Total Parts 45-50 mins 120 Questions NEW TOEIC TEST SERIES 20 0 mins 990 “Practice Makes...
Ngày tải lên: 06/08/2015, 18:11
tóm tắt luận văn thạc sĩ kỹ thuật NGHIÊN cứu ẢNH HƯỞNG của bôi TRƠN làm NGUỘI tối THIỂU đến lực cắt, mòn DỤNG cụ cắt, CHẤT LƯỢNG bề mặt KHI PHAY GANG cầu BẰNG DAO PHAY mặt đầu
... trình phay gang cầu 2. 2 Ảnh hưởng vị trí, số lượng vòi, góc bố trí vòi dẫn dẫn dung dịch vào vùng cắt phay dao phay mặt đầu sử dụng MQL - Phun lên mặt trước dao (hình 2. 2) - Phun vào mặt sau dao ... tool in the drilling of aluminum–silicon alloys, international journalof Macchine & Manufacture 122 (20 02) 127 -138 [26 ] Y.S Liaoa,*, H.M Lina, Y.C Chenb, Feasibility study of the minimum quantity ... dòng khí 4KG/cm2, 5KG/cm2, 6KG/cm2 phút Hình 3 .22 Quan hệ thời gian cắt (phút) lực cắt Fx (N) trương hợp cắt khô; cắt có sử dụng MQL với áp suất dòng khí 4KG/cm2, 5KG/cm2, 6KG/cm2 *Kết luận -...
Ngày tải lên: 18/08/2015, 20:45
Thiêt kế dao phay đĩa mô dunM = 2,5 ; ỏ = 200 ; n06
... 15 Nguyờn cụng XV : Mi l 22 +Mi mt u Mỏy : 3A 227 22 b1: Mi l 22 , s2 s2 Dao : ỏ mi trũn Ctr50TB1G n 2 b2: Mi mt u Dao : ỏ mi vnh khn Ctr50TB1G gỏ: C cu kp n +0, 023 hi nđ1 , s1 s1 +0,03 8,04 ... 1, 022 9 41,097 2, 0459 0,153 0 41,697 2, 1576 0,447 42, 293 2, 338 1,043 44,11 3 12 44,71 23 07 0606 0,05339 0,99857 2, 226 9 44,64 4,4538 3 ,21 45,31 104544 303343 0,059 0,99 825 2, 674 45 ,23 5,349 3,98 ... Phay rónh cha phoi 11 12 8B66 Mõm cp tru 1K 62 1K 62 1K 62 T15K6 Mi khoan p18 Dao tin ct t 3756 3756 Ctr20TB1G Ctr20TB1G Bn t 7510 p18 T15K6 m cu t la Trc gỏ mi tõm 1K 62 1K 62 1K 62 7516 1K 62 6H82...
Ngày tải lên: 23/08/2015, 02:25
Registration, atlas generation, and statistical analysis of high angular resolution diffusion imaging based on riemannian structure of orientation distribution functions 2
... uniqueness The space of such functions is defined as Ψ = {ψ : S2 → R+ |∀s ∈ S2 , ψ(s) ≥ 0; 16 s∈S2 ψ (s)ds = 1} (2. 1) 2. 1 Riemannian Manifold of ODFs We see that from Eq (2. 1), the functions ψ ... ψi , ψj 17 (2. 5) BACKGROUND 2. 2 Large Deformation Diffeomorphic Metric Mapping 2. 2.1 Diffeomorphic Metric In the setting of large deform diffeomorphic metric mapping (LDDMM), the set of anatomical ... Itemp as the minimal length of curves φt · Itemp , t ∈ [0, 1], in a shape space such that, at time 18 2. 2 Large Deformation Diffeomorphic Metric Mapping Figure 2. 2: Flow equation t = 1, φ1 ·...
Ngày tải lên: 08/09/2015, 19:26
Toxicology and pharmacology investigation of 2 phenylaminophenylacetic acid derived NSAIDs implication of chemical structure on biological outcomes
... 23 2. 2.1 Extraction of diclofenac (3) from Voltaren tablets 24 2. 2 .2 Synthesis of compounds 1, and 25 2. 2 .2. 1 Synthesis of 2- iodophenyl-N, N-dimethylacetamide (25 ) 25 2. 2 .2. 2 General ... overnight 24 2. 2 .2 Synthesis of compounds 1, and N OH NH2 CH3 R2 CH3 (a) O O I I R3 + 25 N CH3 OH CH3 O (b) R2 R2 R3 26 F Cl 27 F F 28 Br Br O (c) NH R3 NH R2 R3 R2 R3 F Cl F F Br Br Scheme 2- 1 ... 22 2 Appendix 2- 1: Complete structures of all twenty-four synthesized compounds 22 2 Appendix 2- 2: Characterization of synthesized compounds (1 – 24 ) and imtermediates (25 – 72) ...
Ngày tải lên: 09/09/2015, 11:27
Crystal structure of arabidopsis thaliana cyclophilin 38 (atcyp38 2
... DRKRDAVAPK YEVPEEYRNM IEDCVFRIVL YDGMEIQRSD TEKTRTVPLE YKAQVVIPFN VFWLLKESEL NEDFLADLKV YKIAG 437 1 12 1 42 1 72 2 02 2 32 2 62 2 92 322 3 52 3 82 4 12 Figure 28 The sequence of AtCyP38 (83-437) The native methionine ... 98.1(93.3) 98 .2 (90.9) 98.6 (91.6) Redundancy 6 .2 (5.7) 6.3 (6.0) 6 .2 (5.7) Rsym 0.069 (0 .29 ) 0.059 (0.30) 0.065 (0 .25 ) 0.067 (0 .23 ) 〈I/σ(I)〉 0.9500 21 .40 (5.4) 20 .2 (5.3) 20 .7 (6.5) 6.3 (5.9) 19 .21 (5.1) ... VPEEYRNMPLLKGRASVDMKVKIKDNPNIEDCVFRIVLDGYNAPVTAGN 23 0 25 0 24 0 26 0 27 0 β5 α6 FVDLVERHFYDGMEIQRSDGFVVQTGDPEGPAEGFIDPSTEKTRTVPLE 28 0 300 29 0 310 320 β6 IMVTGEKTPFYGSTLEELGLYKAQVVIPFNAFGTMAMAREEFENDSGSS...
Ngày tải lên: 14/09/2015, 17:50
Structural basis of protein stability at poly extreme crystal structure of amya at 1 6 a resolution 2
... Table 2. 3 Table 2. 3 Coordinating atoms of calcium and distances Calcium No Interacting Atoms ASP 44 OD1 ASP 46 OD1 ASP 48 OD1 ILE 50 O ASP 52 OD2 WAT 27 Distance in Å 2. 47 2. 49 2. 50 2. 45 2. 48 2. 70 ... Distance in Å 2. 59 2. 50 2. 64 2. 58 2. 59 2. 70 Ca 1, the calcium ion, which is coordinated by residues within 44 to 52, is present in most α-amylases, Figs 2. 7, 2. 8 Also, a novel calcium site, Ca2, is also ... salinity range (Fig 2. 10) The activity profiles of AmyA at different temperatures and pH are shown in Figs 2. 11 and 2. 12 Figure 2. 13 AmyA activity profile Activity assay of AmyA using 20 mM Tris (pH...
Ngày tải lên: 16/09/2015, 08:31
Hướng dẫn thực hành 55 kỹ thuật điều dưỡng cơ bản (trọn bộ 2 tập) tập 2 (dùng cho đào tạo cử nhân điều dưỡng)
Ngày tải lên: 05/01/2016, 18:37
THE structure of the multiprogramming system
... section 1; V (mutex) ; remainder of cycle 1; go to L1 end; begin L2: P mutex); critical section 2; V (mutex); remainder of cycle 2; go to L2 end pareud end As a result of the P- and V-operations on ... blocked in the course of task execution relies on the other processes for removal of the barrier Essentially, the proof in question is a demonstration of the absence of "circular waits": process ... errors that 3 42 C o m m u n i c a t i o n s of t h e ACM showed up during testing were trivial coding errors (occurring with a density of one error per 500 instructions), each of them located...
Ngày tải lên: 12/09/2012, 15:05
Thiết kế và chế tạo dao phay lăn răng trục vít (TM+CAD)
... Tổng 2Zmin Kích thớc (àm) tính toán àm Dung sai 160 50 25 50 10 25 0 50 25 50 20 559 33,54 22 ,36 78,4 25 ,5 300 150 25 1988, 82 507,41 364,57 1 029 57 ,22 100968,4 1003 32, 3 100460,99 100096, 42 àm 20 00 ... khe hở Cu1 = 0 ,25 * m Do chiều cao chân dao phay bằng: h2 = m*f + Cu1 thay số : h2 = 3,5*1 + 0 ,25 *3,5 = 4,375(mm) e) Chiều cao toàn prôfin dao phay : h = h1 + h2 : h1- chiều cao đầu dao h2- chiều ... phôi sau dập Vtt=3,14* 52, 7 52* 118*10-6 =1,031 (dm3) Gtt=1,031*8,69 = 8,96 (Kg) Gch=0,03*8,96 = 0 ,26 9 (Kg) Gph=8,96 + 0 ,26 9 = 9 ,22 9 (kg) Vph= 9 ,22 9 10 620 00 = 1,0 62( dm ) L = = 123 (mm) 8,69 3,14 *...
Ngày tải lên: 31/10/2012, 15:07
Bạn có muốn tìm thêm với từ khóa: