towards interdisciplinary perspectives in research and development

Master Thesis in Economics: Approaches to Risk Management in Research and Development: An Analysis  of Public / Private Partnerships in Ireland

Master Thesis in Economics: Approaches to Risk Management in Research and Development: An Analysis of Public / Private Partnerships in Ireland

... with of Industry Funded Academic Research Centres Uncertainty, and hence risk, in IAC joint research projects has been proposed to be higher than in intra and inter company research and development ... an SME IAC involves three stages: searching, screening and signalling Signalling involves determining available knowledge in the literature pertaining to the proposed partner Screening identifies ... task leaders against technical milestones  Defining the outputs and project objectives  Coordinating internal review of project’s outputs  addressing and verifying the coordination between

Ngày tải lên: 09/01/2020, 17:44

130 36 0
International experience of linking between research, education and innovation in research and development organizations

International experience of linking between research, education and innovation in research and development organizations

... for Vietnam in promoting the linkage among research, training and innovation in public R&D organizations Keywords: R&D organization; Link of research, training and innovation; International ... the linkage among research, training and innovation in R&D organizations 1.1 Linkage of research, training and innovation in R&D institutions to meet the new requirements The linkage ... Training and innovation appear to meet new requirements, these two operations provide the basis for development and maintenance of research activities The link among research, training and innovation

Ngày tải lên: 02/02/2020, 17:38

13 81 0
Approaches to risk management in research and development

Approaches to risk management in research and development

... with of Industry Funded Academic Research Centres Uncertainty, and hence risk, in IAC joint research projects has been proposed to be higher than in intra and inter company research and development ... an SME IAC involves three stages: searching, screening and signalling Signalling involves determining available knowledge in the literature pertaining to the proposed partner Screening identifies ... task leaders against technical milestones  Defining the outputs and project objectives  Coordinating internal review of project’s outputs  addressing and verifying the coordination between

Ngày tải lên: 26/04/2020, 22:13

130 40 0
LUẬN văn THẠC sĩ (KINH tế) approaches to risk management in research and development an analysis of public  private partnerships in ireland

LUẬN văn THẠC sĩ (KINH tế) approaches to risk management in research and development an analysis of public private partnerships in ireland

... RiskManagementinResearchandDevelopment:AnAnalysiso f P ublic/PrivatePartnershipsinIreland” Dissertationsubmittedinpart fulfilmentoftherequirementsfortheDegreeofMastersinBusinessAdministration(Project ... 387.5RiskspertainingtoSuitabilityofResources 39 7.6RiskPertainingtoStakeholder Alignment 41 7.7RiskspertainingtoResearchSupports 42 7.8RiskspertainingCriticaltoSuccessFactors(CFS) 43 8.0Introduction ... lex(seeFigure5foranexample)andincludesinteraliatheIndustryPartners,FundingAgencies,theh ostUniversity,theResearchCentre,ThePrincipalInvestigatorsandtheTechnical Transferofficesallofwhichmayhavedifferentdefinitionsofsuccess;hence,theymayalsohaveadiff

Ngày tải lên: 04/05/2021, 19:23

20 12 0
University industry cooperation in research and development (rd) from the perspective of universities in hanoi

University industry cooperation in research and development (rd) from the perspective of universities in hanoi

... establishing University-Industry Research Centers (UIRCs) Other initiatives include designing training programs tailored to business needs, fostering close links in human resource development, and ... Development Partnership in Japan, initiated in the mining and manufacturing sectors, has fostered collaborative research among the state, universities, and industries since its introduction in ... original inventions Research findings play a crucial role in determining the best path towards licensing, starting a new venture, or developing a spinoff company. 2.5 Concept of university-industry

Ngày tải lên: 23/10/2023, 06:19

95 3 0
Luận văn thạc sĩ Quản trị kinh doanh: Innovation management in research and development of technology products at VNPT technology

Luận văn thạc sĩ Quản trị kinh doanh: Innovation management in research and development of technology products at VNPT technology

... recommendations derived from the research findings, focusing on optimizing the R&D environment and fostering continuous learning and development for its engineers.Leverage research insights to shape comprehensive ... process involves a series of stages, from defining the research problem to analyzing data and interpreting findings Each stage is outlined below: The initial phase of the research process involves ... committed to driving innovation in the tech industry.VNPT Technology is enhancing its research and development innovations by scaling them into mass production to satisfy both domestic and international

Ngày tải lên: 10/04/2025, 03:18

90 1 0
Tài liệu Qualitative Research in Psychology: Expanding Perspectives in Methodology and Design pptx

Tài liệu Qualitative Research in Psychology: Expanding Perspectives in Methodology and Design pptx

... advantages and challenges of carrying out this kind of research in the setting of a prison Those with “inside” knowledge were not only able to provide insights into formal and informal practices and INTEGRATING ... in families and at work Against that backdrop, Magnusson examined how the women in her study drew on various meanings of femininity in discussing their roles at work and in their families Using ... are speaking and acting in a social and linguistic context, and so qualitative researchers whose interest is not solely in language neverthe- less find it useful to consider the sociolinguistic

Ngày tải lên: 15/02/2014, 15:20

166 367 0
Nghiên cứu và phát triển kỹ thuật chỗng nhiễu giao thoa trong bộ thu GNSS (research and development of advanced interference mitigation techniques in GNSS receivers)

Nghiên cứu và phát triển kỹ thuật chỗng nhiễu giao thoa trong bộ thu GNSS (research and development of advanced interference mitigation techniques in GNSS receivers)

... Bandwidth Receiver Interference Threshold Linearly increasing from -120 dBm to -113.5 dBm Linearly increasing from -113.5 dBm to -110.5 dBm -110.5 dBm Linearly increasing from -110.5 dBm ... estimation of the interference bandwidth ( ) 56Figure 4.3 Estimated interference bandwidth over time, in case of variable band 57Figure 4.4 Theoretical and practical C/N0 when bandwidth of interference ... both in terms of accuracy and continuity, are becoming more and more stringent GNSS systems like GPS and Galileo are based on the Direct Sequence-Spread Spectrum (DS-SS) technique, which intrinsically

Ngày tải lên: 26/07/2017, 21:03

63 263 0
RESEARCH AND DEVELOPMENT OF HYBRID RICE IN VIETNAM

RESEARCH AND DEVELOPMENT OF HYBRID RICE IN VIETNAM

... (3 line) Spring China 7-8.5 2000 Er you 63 (3 line) Spring China 7-8.5 2000 Sin 6 (3 line) &summer Spring China 7-9 2007 D you 527 (3line) Spring China 7-9 2001 VL20 (2 line) HC1 (2 line) ... support the following research and development activities. government for approval that will create a base for investment and development. leading and coordinating hybrid rice research in Vietnam ... policy and final support to promote hybris rice research and development2.2.2.1 Strengthen government commitment, policy and final support to promote hybris rice research and development Development

Ngày tải lên: 15/05/2018, 16:58

63 158 0
Research and development of genetic engineering in medicine and agriculture in the united states of America

Research and development of genetic engineering in medicine and agriculture in the united states of America

... types and/or subtypes In breast cancer, for instance, many studies indicated that NGS is suitable for detecting point mutations and indels in the BRCA1/BRCA2 gene In addition, when examining 25 ... editing therapy in treating disease cells and tissues, removing or modifying harmful mutations, introducing protectable mutations, supplementing therapeutic genes, or disrupting the viral DNA In ... status of research, development and application of genetic technology in the US has been reflected through efforts and accomplishments in numerous fields including research, medicine, industrial

Ngày tải lên: 09/01/2020, 19:04

15 68 0
Road map for renewable energy research and development in Egypt

Road map for renewable energy research and development in Egypt

... (RE) including solar, wind and biomass energy Renewable energy technologies (RETs) and systems have different needs for sup-port in terms of research and development, demonstration and market development ... foreign direct investment and become a leader in the export of medium-technology engineering products in the MENA region In this context, RE is a priority area for short and long-term industrial ... consultation and to carry out an in-depth quantitative and qualitative analysis taking into account key variables such as develop-ments in energy pricing and technology advances 3 To formulate a clear development

Ngày tải lên: 11/01/2020, 23:31

10 40 0
Research and development activity to serve innovations in enterprises of processing and manufacturing sectors in Vietnam

Research and development activity to serve innovations in enterprises of processing and manufacturing sectors in Vietnam

... through internal training activities inside enterprises or purchase (by hiring); tacit and informal learning - “learning by doing” (iv) They can invest in equipment, software or intermediate inputs ... Trang 1RESEARCH AND DEVELOPMENT ACTIVITY TO SERVE INNOVATIONS IN ENTERPRISES OF PROCESSING AND MANUFACTURING SECTORS IN VIETNAM Ho Ngoc Luat 1 Ministry of Science and Technology Abstract: Research ... which undertake innovations in processing and manufacturing sectors in Vietnam during 2014-2016 period Concrete works of analysis and evaluation of R&D activities for innovations in enterprises

Ngày tải lên: 16/01/2020, 12:43

20 27 0
Research and development in industry 1976 1997 expenditure and researchers, scientists and engineersrecherche et development

Research and development in industry 1976 1997 expenditure and researchers, scientists and engineersrecherche et development

... Non-electrical machinery 29 Machinery, nec 3825 Office and computing machinery 30 Office, account and computing machin 383-3832 Electrical machinery excluding radio, TV 31 Electrical machinery and communication ... on the business enterprise expenditure on R&D (BERD) and researchers, scientists and engineers (RSE) maintained enter-by the OECD: the Analytical Business Enterprise Research and Development ... and Development (OECD) shall promote policies designed: – to achieve the highest sustainable economic growth and employment and a rising standard of living in Member countries, while maintaining

Ngày tải lên: 20/01/2020, 07:51

149 31 0
History of establishment and development of technological research and development organizations under ministries in Vietnam

History of establishment and development of technological research and development organizations under ministries in Vietnam

... as Institute of Industrial Machines and Tools, Institute of Mechanical Research, S&T Research Institute of Mining and Metallurgy (MOIT); Vietnam Institute of Agricultural Engineering and ... specific needs of line ministries (including some research institutes under administration of People’s Committees of certain large cities and provinces); and (iii) Research units in producing organizations ... (actually Ministry of Agriculture and Rural Development - MARD) and Institute of Research and Design of Agricultural Machines under administration of Ministry of Mechanics and Metallurgy (actually Ministry

Ngày tải lên: 02/02/2020, 13:53

17 36 0
Vital Assets - Federal Investment in Research and Development at the Nation’s Universities and Colleges potx

Vital Assets - Federal Investment in Research and Development at the Nation’s Universities and Colleges potx

... for advancing general knowledge, fulfilling federal missions, training future scientists and engineers, and ensuring the prosperity of universities and colleges and the economic settings in which ... DOD, in which case New York and Illinois trade sixth and seventh place, and Georgia and North Carolina trade tenth and eleventh; and NASA, in which case Texas and Massachusetts trade fourth and ... eligible institutions in the states and compared it with the institutions that actually obtained such funds in FY 2002 Not surprisingly, every MD-granting institution in every state sought and obtained...

Ngày tải lên: 15/03/2014, 22:20

189 758 0
Latest Findings in Intellectual and Developmental Disabilities Research Edited by Üner Tan potx

Latest Findings in Intellectual and Developmental Disabilities Research Edited by Üner Tan potx

... follow the command, and none could even take the paper in their hands Table Questions from the Mini Mental State Examination Test and Patients Answers Latest Findings in Intellectual and Developmental ... Latest Findings in Intellectual and Developmental Disabilities Research imitating a dog and goat and other animals to admiration. As reported by Tan (2010a), the UTS cases occur in consanguineous ... Latest Findings in Intellectual and Developmental Disabilities Research to biological systems However, new insights have been gained through increasing cooperation between biological sciences and...

Ngày tải lên: 23/03/2014, 17:20

404 396 0
RESEARCH AND DEVELOPMENT ACTIVITIES IN PRINTED INTELLIGENCE pptx

RESEARCH AND DEVELOPMENT ACTIVITIES IN PRINTED INTELLIGENCE pptx

... multi-disciplinary approach in its printed intelligence developments Expertise in e.g in biotechnology, paper, electronics etc are combined in our daily projects and researcher interactions The diverse research ... groundbreaking investments in its printed intelligence equipment and facilities, particularly with roll-to-roll, printing and coating lines Our larger scale investments started with the rotogravure and ... acceptable Embossing tests were initially done in the laboratory with a flat bed machine and then with a pilot machine containing two printing units and an embossing unit The web width is 200 mm and the...

Ngày tải lên: 01/04/2014, 00:20

81 351 0
Báo cáo nghiên cứu khoa học " Strengthening Capacity in Forest Tree Seed Technologies Serving Research and Development Activities and ex-situ Conservation - MS4 " potx

Báo cáo nghiên cứu khoa học " Strengthening Capacity in Forest Tree Seed Technologies Serving Research and Development Activities and ex-situ Conservation - MS4 " potx

... opening of the stand by thinning The increase in tree vigour resulting from thinning and fertilisation enables the development of heavier and denser crowns that will produce more flowers N containing ... remaining trees in the stand This will provide useful reference to each tree in the future when assessment of flowering and seed production is required Thinning Seed Production Areas Thinning ... thinnings each removing 50% of trees Stocking: Initial : 1250 stems/ha After 1st thin : 625 After 2nd thin 312 After 3rd thin 150 Collect seed from remaining, superior, trees after mass flowering...

Ngày tải lên: 22/06/2014, 12:20

14 311 0
Báo cáo nghiên cứu khoa học " Strengthening Capacity in Forest Tree Seed Technologies Serving Research and Development Activities and ex-situ Conservation " pptx

Báo cáo nghiên cứu khoa học " Strengthening Capacity in Forest Tree Seed Technologies Serving Research and Development Activities and ex-situ Conservation " pptx

... pollination, carefully minimising the potential of inbreeding and allowing for material from other sources to be incorporated In pursuing its principal functions of efficient selection and mating, ... after measuring all trees for height and diameter reduce stocking to maintain vigorous growth of remaining trees and promote early flowering Selection of outstanding trees for grafting into clone ... in Indonesia Randomised latinised row-column design with replicates, 4-tree line plot in each replicate, spacing 4m between row and 1.5m within rows (1666/ha) First thinning at years of age in...

Ngày tải lên: 22/06/2014, 12:20

44 337 0
Báo cáo nghiên cứu khoa học " Strengthening Capacity in Forest Tree Seed Technologies Serving Research and Development Activities and ex-situ Conservation " potx

Báo cáo nghiên cứu khoa học " Strengthening Capacity in Forest Tree Seed Technologies Serving Research and Development Activities and ex-situ Conservation " potx

... Capacity Building Training of RCFTI staff has been the key activity within the reporting period as outlined above and in the Logframe In summary, the following training and supporting information was ... consignment notes containing necessary seedlot information iv Monitoring of staff during training v Uptake of training in every day use when handling seed without supervision vi Document in use ii Document ... Training to be provided Training provided as per schedule Training in seed processing and laboratory work undertaken by B Gunn in this reporting period i In conjunction with a visit to Vietnam in...

Ngày tải lên: 22/06/2014, 12:20

20 262 0
w