pericytes in development and pathology of skeletal muscle

báo cáo hóa học:" Development and evaluation of a clinical algorithm to monitor patients on antiretrovirals in resource-limited settings using adherence, clinical and CD4 cell count criteria" ppt

báo cáo hóa học:" Development and evaluation of a clinical algorithm to monitor patients on antiretrovirals in resource-limited settings using adherence, clinical and CD4 cell count criteria" ppt

... Hopkins University School of Medicine, Baltimore, USA, 3 SAIC Frederick, MD, USA, 4 National Institute of Allergy and Infectious Diseases, National Institutes of Health, USA and 5 Institute of ... failure and better allocate viral load testing in RLS. Increased sensitivity of monitoring algorithms may reduce the number of patients continued on failing ART regimens and limit the development of ... Division of Intramural Research of the National Institute of Allergy and Infectious Diseases, part of the National Institutes of Health, USA. We also acknowledge support from the Career Development

Ngày tải lên: 20/06/2014, 08:20

10 533 0
báo cáo hóa học:" The positive mental health instrument: development and validation of a culturally relevant scale in a multi-ethnic asian population" pdf

báo cáo hóa học:" The positive mental health instrument: development and validation of a culturally relevant scale in a multi-ethnic asian population" pdf

... time and coverage of these measures. A brief description of the instruments is provided in Table 3. Missing data and floor and ceiling effect Missing data and floor and ceiling effect were investi- ... statistical and psychometric analyses MOE guided, trained and performed the psychometric analyses and interpreted the findings LP led the field work and training of interviewers ... health is a state of complete physical, mental and social well-being and not merely the absence of disease or infirmity and mental health is ‘a state of well-being in which every individual realizes

Ngày tải lên: 20/06/2014, 15:20

18 487 0
Báo cáo khoa học nông nghiệp " Selection and development sweet potato varieties with high root quality for food processing in Northern and Central of Vietnam " MS4 pot

Báo cáo khoa học nông nghiệp " Selection and development sweet potato varieties with high root quality for food processing in Northern and Central of Vietnam " MS4 pot

... staff in Science and Agriculture, extension of techniques to improve quality of seed and plant breeding, technologies of crop preservation and processing and quality inspection methods of finished ... all of the cattle manure and Lan super as well as 30% of Urea and 30% of Kali for treament before planting - Half of the remaining Urea and Kali lefts was fertilized 20-25 days after planting ... Binh, Tinh Gia, Thanh Hoa S6= Quang Minh, Quang Xương, Thanh Hoa The vine-leaf yields of the new varieties in Bac Giang and Thanh Hoa in the winter season 2008 were calculated and presented in

Ngày tải lên: 21/06/2014, 04:20

16 395 0
Báo cáo khoa học nông nghiệp " The development and implementation of new appropriate technologies for improving goat production and increasing small-holder income in the central region of Vietnam - MS2 " potx

Báo cáo khoa học nông nghiệp " The development and implementation of new appropriate technologies for improving goat production and increasing small-holder income in the central region of Vietnam - MS2 " potx

... focus of the project at this stage has been the training of DARD officers from Ninh Thuan, Binh Thuan and Lam Dong provinces in goat husbandry and management, in the conduct of surveys and the ... meet in Lam Dong in November 2006, in Binh Thuan in 2007 and in Ninh Thuan in 2008. It is hoped that this Board will provide and official forum for interaction between CARD and DARD staff in ... May) and involvement of the team with the conduct of a training coursefor DARD officers at GRRC, development and application of a questionnaire to 27 farms (farmers) in Ninh Thuan, Binh Thuan and

Ngày tải lên: 21/06/2014, 06:20

12 543 0
Project Progress Report: The development and implementation of new appropriate technologies for improving goat production and increasing small-holder income in the central region of Vietnam - MS3 " doc

Project Progress Report: The development and implementation of new appropriate technologies for improving goat production and increasing small-holder income in the central region of Vietnam - MS3 " doc

... financial and social status of 27 target farms, physical and financial status of 30 farms outside project and survey of existing structure and farming practices of goat farmers in target provinces” ... elements of farm survey, strategic planning for improving health and nutrition of goats, as well as training of key farmers and Department of Agriculture and Rural Development (DARD) staff in these ... Identification and characterisation of target farms Training and Information Dissemination Provision of improved housing and health care for goats Improve the availability and quality of feeds and forages

Ngày tải lên: 21/06/2014, 06:20

13 660 0
the development and adoption of legal normativedcuments by state administrative agencies in the people’s democratic republic of laos

the development and adoption of legal normativedcuments by state administrative agencies in the people’s democratic republic of laos

... Government and Prime Minister In addition, the ministry is directly involved in all phases of the developing and promulgating legal normative documents 3.2.2.2 Prime Minister’s Office The drafting and ... construction of legal normative documents which is increasing in number and pressing in time during those days The responsibility of ministries and ministerial-level bodies in developing legal normative ... capable, and of professional qualification satisfying requirements for the development and completion of laws in the framework of administrative reform, and development of a socialist state of law

Ngày tải lên: 17/07/2014, 20:11

30 328 0
Báo cáo lâm nghiệp: " Early development and nutrition of Norway spruce (Picea abies (L.) Karst.) seedlings on different seedbeds in the Bavarian limestone Alps – a bioassay" ppsx

Báo cáo lâm nghiệp: " Early development and nutrition of Norway spruce (Picea abies (L.) Karst.) seedlings on different seedbeds in the Bavarian limestone Alps – a bioassay" ppsx

... a combined with low concentrations of Ca and Mg resulted in ranges of harmonic element relations for N to K, Ca, and Mg as well as for K to Ca, and Mg in needles of seedlings grow- ing in decayed ... a ICP-IES (Perkin Elmer Optima 3000). 2.5. Sampling and identification of ectomycorrhizae (ECM) In mid of October 2003, the total remaining seedlings of each pot (approx. 15 seedlings) were harvested ... geophilum) and distinguished two Tomentella-like morphotypes TOM-01 and TOM-02. As a result of the initiated and thus rudimentary infection of root tips, numerous morphotypes were indeterminable (in-

Ngày tải lên: 08/08/2014, 00:22

10 353 0
Báo cáo khoa học: " Humus form development and succession of dwarf shrub vegetation in grass dominated primary Pinus sylvestris forests" ppt

Báo cáo khoa học: " Humus form development and succession of dwarf shrub vegetation in grass dominated primary Pinus sylvestris forests" ppt

... to maintain dominance in the herb layer for a long period of time during succession in pine forests. 3) Facilitation in the succession of the undergrowth of the pine ... nigrum and Vaccinium myrtillus), D flexuosa and forest mosses. The declining vigour of D flexu- osa has been established from decreasing flow- ering intensity and increasing ... and 124-year-old stands on sand dunes. Vegetation descriptions concern cover percentages of the herb and moss species and vertical distribution of herb and pine roots in

Ngày tải lên: 08/08/2014, 19:21

11 329 0
báo cáo khoa học: "Task shifting and integration of HIV care into primary care in South Africa: The development and content of the streamlining tasks and roles to expand treatment and care for HIV (STRETCH) intervention" ppt

báo cáo khoa học: "Task shifting and integration of HIV care into primary care in South Africa: The development and content of the streamlining tasks and roles to expand treatment and care for HIV (STRETCH) intervention" ppt

... Task shifting and integration of HIV care into primary care in South Africa: The development and content of the streamlining tasks and roles to expand treatment and care for HIV (STRETCH) intervention ... • Routine HIV care (repeat CD4 counts, clinical staging and TB screening) for patients not requiring ART • Drug readiness training • Baseline bloods • Monthly ART follow-up and issuing of ARVs ... clinics, and links to manuals used in the intervention, as suggested in the WIDER recommendations (Workgroup for Intervention Development and Evaluation Research) [24] The development of the intervention

Ngày tải lên: 10/08/2014, 11:20

11 500 0
báo cáo khoa học: "Targeting tumorigenesis: development and use of mTOR inhibitors in cancer therapy" ppsx

báo cáo khoa học: "Targeting tumorigenesis: development and use of mTOR inhibitors in cancer therapy" ppsx

... Rüschoff J, Langner C: Analysis of insulin-like growth factors and insulin-like growth... clinical trial of daily and weekly RAD001 in combiantion with vinorelbine and trastuzumab in ... patients (11 in cohort 1 and 14 in cohort 2) a PR rate of 17% was observed. A number of phase I and II trials evaluating everolimus in combination with TKIs and other agents are ongoing, including a ... 9.6% in stratum 1 and 4.4% in stra- tum 2. Stable disease was maintained in 68% of patients in stratum 1 and 80% of patients in stratum 2. Median PFS (by central radiology) was 9.7 months in stratum

Ngày tải lên: 10/08/2014, 22:20

12 264 0
báo cáo khoa học: " Exploiting EST databases for the development and characterization of EST-SSR markers in castor bean (Ricinus communis L.)" pptx

báo cáo khoa học: " Exploiting EST databases for the development and characterization of EST-SSR markers in castor bean (Ricinus communis L.)" pptx

... breeding and improvement of varieties. There is an increasing need for distinguishing the varieties reli- ably, establishin g their purity, and fingerprinting released varieties, hybrids and the ... Chinese Academy of Sciences, 88 Xuefu Road, Kunming 650223, PR China. 2 SW China Germplasm Bank of Wild Species, Kunming Institute of Botany, Chinese Academy of Sciences, Kunming 650204, PR China. ... common feature of EST-SSRs and has often been f ound in other organisms. This could be a result of selection and evolution, since tri- and hexa- SSRs do not change the coding frame in coding regions

Ngày tải lên: 11/08/2014, 11:21

10 470 0
báo cáo khoa học: " The development and geometry of shape change in Arabidopsis thaliana cotyledon pavement cells" doc

báo cáo khoa học: " The development and geometry of shape change in Arabidopsis thaliana cotyledon pavement cells" doc

... both at indentations and within the tips and flanks of expanding lobes (Figure 3B). Of the 17 Figure 2 Reorganization of GFP:TUB6 labeled cortical microtub ule arrays in actively expanding cotyledon ... horizontal line indicated in panel (B). (D) YZ view of the anticlinal wall of the region boxed in red in panel (A). (E) Fluorescent intensity values scanned along the horizontal line indicated in panel ... dete cted using freeze shattering and immunolocali zation. Regions of interest in are labeled a’ xy view and b’ xy view. Insets are projections of the xz and yz views of subregions a ’ and b’, respectively.

Ngày tải lên: 11/08/2014, 11:21

13 406 0
báo cáo khoa học:" Development and validation of a short version of the Assessment of Chronic Illness Care (ACIC) in Dutch Disease Management Programs" doc

báo cáo khoa học:" Development and validation of a short version of the Assessment of Chronic Illness Care (ACIC) in Dutch Disease Management Programs" doc

... of the four main components of the CCM only). A year later (2010) most DMPs finished implementing the interventions of their DMP (e.g. ICT-systems, training professionals) and started including ... management, using new types of health professionals, redefining professionals’ roles and redistributing their tasks, planned interaction between professionals, and regular follow-up meetings by the ... cut-off point of 0.08), indicating a good global fit of the overall model. The final short model on imputed data resulted in comparable factor l oadings and its model indices showed good fit. Internal

Ngày tải lên: 12/08/2014, 01:22

10 392 0
Báo cáo y học: "Oxygen-sensing mechanisms and the regulation of redox-responsive transcription factors in development and pathophysiology" ppsx

Báo cáo y học: "Oxygen-sensing mechanisms and the regulation of redox-responsive transcription factors in development and pathophysiology" ppsx

... (blocked arrows) of different stages in the proposed pathway are indi - cated. Genistein is an inhibitor of tyrosine protein kinase and competi- tive inhibitor of ATP in other protein kinase reactions; ... disturbances and the development of lung injury [ 5,8,10,22,35]. A wealth of data has drawn attention to both the significance of maintaining reducing conditions in cells and the fight against the ... perturbations in maintaining homeostatic mechanisms in response to changes in oxygen levels are critical in deter - mining cellular characteristic integrity. The clinical, bio- chemical and histologic

Ngày tải lên: 12/08/2014, 18:20

27 342 0
Báo cáo y học: "Development and implementation of a performance improvement project in adult intensive care units: overview of the Improving Medicine Through Pathway Assessment of Critical Therapy in Hospital-Acquired Pneumonia (IMPACT-HAP) study" doc

Báo cáo y học: "Development and implementation of a performance improvement project in adult intensive care units: overview of the Improving Medicine Through Pathway Assessment of Critical Therapy in Hospital-Acquired Pneumonia (IMPACT-HAP) study" doc

... analysis and interpretation of data, and to drafting of the manuscript and critical revision for important intellectual content. All authors read and approved the final manuscript. Competing interests ... or HCAP [1], including clinical suspicion of evolving pneumonia while in the ICU, with new or pro- gressive infiltrates on chest radiograph and at least two of the following: new or increased cough, ... we developed a series of quality indicators and herein report our find- ings before and after implementation of this perfor- mance improvement project. Preliminary findings have been previously

Ngày tải lên: 14/08/2014, 07:21

10 429 1
The development and study of titanium dioxide based buoyant composite photocatalyts for improved applications in photocatalytic degradation of organic pollutants in aqueous solutions

The development and study of titanium dioxide based buoyant composite photocatalyts for improved applications in photocatalytic degradation of organic pollutants in aqueous solutions

... DEGREE OF DOCTOR OF PHILOSOPHY DEPARTMENT OF CIVIL AND ENVIRONMENTAL ENGINEERING NATIONAL UNIVERSITY OF SINGAPORE 2012 Acknowledgement First of all, I would like to thank my supervisor Prof Bai ... degradation of humic acids as a model of organic compounds of landfill leachate in pilot-plant experiments: Influence of inorganic salts, Appl Catal B-Environ., 53, pp 127-137 2004 A W Xu, Y Gao and ... Liu Changkun, Dr Wee Kin Ho, Dr He Yi, Dr Han Wei, Ms Tu Wenting, Ms Zhang Linzi and Mr Zhu Xiaoying Over the past years, we have grown together and I indeed enjoyed working with them My thanks

Ngày tải lên: 10/09/2015, 15:50

192 453 0
Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 1

Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 1

... ANALYSIS OF REGULATOR OF G-PROTEIN SIGNALING (RGS) FUNCTION IN GROWTH, DEVELOPMENT AND PATHOGENICITY OF MAGNAPORTHE GRISEA HAO LIU NATIONAL UNIVERSITY OF SINGAPORE 2006 ANALYSIS OF REGULATOR OF ... identification of an insertional mutant TMT1398, in which a gene (RGS1) encoding an RGS-domain containing protein was disrupted. TMT1398 and an rgs1∆ strain showed pleiotropic defects such as soaking phenotype, ... physically interacts with MagC……………………………………… .11 6 Figure 39 Soft surfaces... nutrients during mating and virulence, and MAP kinase cascade that senses pheromone during mating, and also

Ngày tải lên: 14/09/2015, 09:13

220 230 0
Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 2

Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 2

... PLTPHRVRLTKIDHTFLSEDAINNLGSLKFSQSNRMPDPKDVARIVTTTTTTTFSMAKEM PLSAHRVRLTKVEHTFLSEDAINNLGSLKFSQSNRMPDPKDPSRIVTTTTTTTFSMAKDM -LDSHRVRFTKYDHTFTSEEAINNLGSLKFSQSNRMPDPKDPSRIVTTTTTTTFSMAKEM TFEKSKPEQGWQAQIGNIDINDLERVSPLAHRFFTNPDSESHTQYYVSNAGIRLFENKTF ... GLVGVKMAKERKINDKIYMNTFTGK-AAVDWLMDCSTTIERRETVLIAELFVKYGLITML GFSQDMLISSSNLNKLDYVLTDPGMRYLFRRHLEKELCVENLDVFIEIKRFLKKMTILKK Rgs1 Cprgs-1 FlbA Sst2 467 272 479 466 QQDRSHIQQFPGCQVFQPTKHAIYHMTSKGKDMINGSVPRGRASEGDATHSATHRHG-VA ... 21 A rgs1D WT Rgs1 OP Complemented B WT rgs1D Complemented Rgs1 OP _ Figure 22 Inductive Non-inductive _ Figure 23 WT rgs1D Complemented Figure 24 Figure 25 Figure 26 Rgs1

Ngày tải lên: 14/09/2015, 09:24

12 187 0
Development and application of liquid phase microextraction techniques in the analysis of environmental pollutants

Development and application of liquid phase microextraction techniques in the analysis of environmental pollutants

... Preconcentration of aminoalcohols in urine by combined use of offcolumn static three-phase LPME and on-column stacking for trace analysis by CZE ………………………………………………………………………….114 4.3.1.1 Determination of aminoalcohols ... phase of the outer drop contained the analyte of interest and was continuously delivered and aspirated away throughout the sampling The analytical response of the instrument ... of which are organic, are invented and brought into use at a rate of over 1000 per year [2] Many of these will find their way into the aqueous environment as industrial... effects and

Ngày tải lên: 17/09/2015, 17:20

167 591 0
Báo cáo khoa học: Mapping contacts between regulatory domains of skeletal muscle TnC and TnI by analyses of single-chain chimeras potx

Báo cáo khoa học: Mapping contacts between regulatory domains of skeletal muscle TnC and TnI by analyses of single-chain chimeras potx

... us a step closer to understanding the action of troponin, some portions of the inhibitory and C-ter- minal domains of TnI are lacking in this model and more structural information is necessary ... and 148 are involved in the binding to N domain of TnC [11–16]. Serial deletion studies of the C terminus of TnI showed that residues 166–182 are involved in binding to the thin filament [16]. Altogether, ... binding sub- unit that possesses two Ca 2+ -binding sites per domain [3,4]. TnI inhibits the actomyosin Mg 2+ -ATPase in the presence of tropomyosin and inhibition is removed by TnC [5]. The inhibitory...

Ngày tải lên: 16/03/2014, 18:20

12 577 0

Bạn có muốn tìm thêm với từ khóa:

w