function logic and context of a module

giải tích 1 lê xuân đại the limit and continuity of a function sinhvienzone com

giải tích 1 lê xuân đại the limit and continuity of a function sinhvienzone com

... L ∈ R is called the limit of f (x) as x approaches a, and we write x→a f (x) = L means that the values of f (x) can be made Dr Lê Xuân Đại (HCMUT-OISP) THE LIMIT AND CONTINUITY OF A FUNCTION HCM ... interval (a, b) and Trang 28Suppose that g is continuous at a and f is continuousat g(a) Then, the composition f ◦ g is continuous at a lim x→a (f ◦g)(x) = lim x→a f (g(x)) = f ³ lim x→a g(x) ... Trang 1THE LIMIT AND CONTINUITY OF A FUNCTIONE LECTRONIC VERSION OF LECTURE Dr Lê Xuân Đại HoChiMinh City University of Technology Faculty of Applied Science, Department of Applied Mathematics

Ngày tải lên: 30/01/2020, 21:47

68 88 0
The significance and robustness of a plasma free amino acid (PFAA) profile-based multiplex function for detecting lung cancer

The significance and robustness of a plasma free amino acid (PFAA) profile-based multiplex function for detecting lung cancer

... 32 Maeda J, Higashiyama M, Imaizumi A, Nakayama T, Yamamoto H, Daimon T, Yamakado M, Imamura F, Kodama K: Possibility of multivariate function composed of plasma amino acid profiles as a novel ... Yamamoto, and Ms Naoko Kageyama for the amino acid analysis, Dr Katsuhisa Horimoto for help with the statistical analysis, and Ms Mariko Takasu and Ms Tomoko Kasakura for help with data acquisition ... provided data analysis and wrote the manuscript AI and TD performed statistical analyses All authors read and approved the final paper. Acknowledgements We thank Dr Hiroshi Miyano, Mr Takashi Yamamoto,

Ngày tải lên: 05/11/2020, 07:11

10 11 0
Design and modeling of a voltage frequency controller for network on chip routers based on fuzzy logic

Design and modeling of a voltage frequency controller for network on chip routers based on fuzzy logic

... Where n and m are the numbers of MSFs of at 4 Simulation and Implementation Results After all of blocks of the controller had been modeled at RTL level, we simulate the operators testbench of each ... the value of each input is 0x28 and then the output has a value of 0x4F This result is accordant with the calculation results All testing results have proved that the operations of FLP are in accordance ... fuzzy logic algorithm for NoC analyzes the communication traffic and the variation of this traffic at the target network router frequency and voltage applied to the router The Table 3: Comparison

Ngày tải lên: 17/03/2021, 20:26

10 2 0
Using relevant theories and company illustrations, undertake a detailed evaluation of the company's global strategy  undertake in  depth company research centered on the main topics and concepts of the module itself

Using relevant theories and company illustrations, undertake a detailed evaluation of the company's global strategy undertake in depth company research centered on the main topics and concepts of the module itself

... purchases and are seeking brands that use sustainable materials and ethical labor practices The demand for diversity and inclusivity in fashion is also increasing, with a broader range of sizes, ... well such as when a manager and a few employees were fired because they changed the name of a product in the store to include a racial slur Appropriate legal action was also taken against them ... offer Of course, the essence of fast fashion is its low price, and fast fashion has been labeled cheap “chic chic” because both H&M and Zara are renowned for their one-time quality and ease of

Ngày tải lên: 04/07/2025, 09:04

32 0 0
Tài liệu Báo cáo khoa học: Identification, sequencing, and localization of a new carbonic anhydrase transcript from the hydrothermal vent tubeworm Riftia pachyptila docx

Tài liệu Báo cáo khoa học: Identification, sequencing, and localization of a new carbonic anhydrase transcript from the hydrothermal vent tubeworm Riftia pachyptila docx

... wide range of eukaryotic organisms, they are also widespread in the Archaea and Bacteria domains [11] Among the broad range of physiological processes in which they participate, CA can play a significant ... 99) Fungia scutaria (FCA-a and FCA-b) and Caenorhabditis elegans (CA1 and CA2) sequences fall outside of clade I and are more closely related to each other (BPNJ ¼ 51) (Fig 4, clade II) Although ... a H64 also shared by A gambiae, A aegypti, T gigas, D melanogaster-2 and D melanogaster-3 sequences (data not shown) By contrast, R pachyptila amino acid sequences do not have any of these CAII

Ngày tải lên: 18/02/2014, 16:20

14 591 0
Tài liệu Báo cáo khoa học: Production and characterization of a secreted, C-terminally processed tyrosinase from the filamentous fungus Trichoderma reesei ppt

Tài liệu Báo cáo khoa học: Production and characterization of a secreted, C-terminally processed tyrosinase from the filamentous fungus Trichoderma reesei ppt

... AAA AGC AGG CTA TCA TGC TGT TGT CAG GTC CCT CTC G; and reverse, GGG GAC CAC TTT GTA CAA GAA AGC TGG GTC AGT GGT GGT GGT GGT GGT GCA GAG GAG GGA TAT GGG GAA CGG CAA A The PCR reaction was done ... well as in eukaryotic microorganisms, and in mammals, inverte-brates and plants Tyrosinase is a mono-oxygenase and a bifunctional enzyme that catalyzes the o-hydroxyla-tion of monophenols and ... 5¢ and 3¢ ends, respectively The primers used were as follows: forward primer, GTT GGA ATT CCA TCA TCA TCA TCA TCA TCA GGG CAC GAC ACA CAT CCC C; and reverse primer, GAT CGG TAC CTC ATT ACA GAG

Ngày tải lên: 19/02/2014, 06:20

14 652 0
Tài liệu The Design and Performance of a Real-time CORBA Event Service doc

Tài liệu The Design and Performance of a Real-time CORBA Event Service doc

... implemen-tations and (2) automating many common network program-ming tasks, such as object registration, location, and acti-vation; request demultiplexing; framing and error-handling; parameter marshalling ... inflex-ibility of tightly coupled software can substantially increase the effort and cost of integrating new and improved avionics features For example, navigation suites are a source of contin-ual change, ... control applications would require I/O Facades that actively acquire data from the Sensor Proxies If data was not avail-able to be pulled, the calling I/O Facade would need to block awaiting a result

Ngày tải lên: 19/02/2014, 18:20

20 745 0
Tài liệu Báo cáo khoa học: Purification and characterization of a membrane-bound enzyme complex from the sulfate-reducing archaeon Archaeoglobus fulgidus related to heterodisulfide reductase from methanogenic archaea pdf

Tài liệu Báo cáo khoa học: Purification and characterization of a membrane-bound enzyme complex from the sulfate-reducing archaeon Archaeoglobus fulgidus related to heterodisulfide reductase from methanogenic archaea pdf

... contains typical archaeal promoter elements The sequence AAAGGTTAATATA was found 64 bp upstream of the start codon of AF499; this corresponds to the BRE element and the box A element of archaeal promoters ... with an apparent molecular mass of 53 kDa appears as a double band in unboiled samples (lanes A1 and B1). Table 1 N-Terminal sequences of the polypeptides of the purified enzyme N-Terminal sequences ... overlap by 3 bp) The region 81–65 bp upstream of the start codon of AF499 was identified as an archaeal promoter element by sequence analysis The sequence AAAGGTTAATATA shows a high level of identity

Ngày tải lên: 21/02/2014, 03:20

10 566 0
Báo cáo khoa học: Staphylococcus aureus elongation factor G – structure and analysis of a target for fusidic acid pdf

Báo cáo khoa học: Staphylococcus aureus elongation factor G – structure and analysis of a target for fusidic acid pdf

... Trang 1analysis of a target for fusidic acidYang Chen, Ravi Kiran Koripella, Suparna Sanyal and Maria Selmer Department of Cell and Molecular Biology, Uppsala University, Sweden ... mutation sites are displayed as side chains and located in domain III, domain V and the interface of domains G, III and V (B) Mutation sites in domain are facing the ribosome, and the four-stranded b-sheet ... which coordinates the a-phosphate and b-phosphate, and two so-called switch regions, which coordinate the c-phosphate and change conformation between a tense GTP state and a relaxed GDP state [17]

Ngày tải lên: 06/03/2014, 22:21

15 475 0
Báo cáo khoa học: Synthesis and characterization of a new and radiolabeled high-affinity substrate for H+/peptide cotransporters pdf

Báo cáo khoa học: Synthesis and characterization of a new and radiolabeled high-affinity substrate for H+/peptide cotransporters pdf

... Chal-font, UK) Dexamethasone, apotransferrin, Gly-Gln, Ala-Ala, Ala-Ala-Ala-Ala, Lys-Lys, d-aminolevulinic acid, cefadroxil, Gly, Pro-Ala, 8-aminooctanoic acid and Gly-Sar were from Sigma-Aldrich ... cells was inhibited not only by unlabeled Bip-Pro itself, but also by well known sub-strates of H+⁄ peptide cotransporters, such as Gly-Sar, Ala-Ala, Lys-Lys, Ala-Asp, d-Phe-Ala, Ala-Ala-Ala, d-aminolevulinic ... inves-tigation because of their physiological importance and their pharmaceutical relevance as drug carriers [1–6] Both transporters catalyse the uptake of most dipep-tides and tripepdipep-tides and a

Ngày tải lên: 07/03/2014, 05:20

10 491 0
PROCEDURES ON IMPORTATION AND REGISTRATION OF A CAR IN SINGAPORE doc

PROCEDURES ON IMPORTATION AND REGISTRATION OF A CAR IN SINGAPORE doc

... Intensity Discharge (HID) Headlamps Annex Certificate of Compliance with Exhaust Emission Standards – Submission Format B Trang 2IMPORTATION AND REGISTRATION OF NEW AND USED CARS IN SINGAPORE Vehicle ... diesel-driven car); or c) Get your car tested and certified by any of LTA/NEA-recognised vehicle test laboratories (listed in Annex A) The laboratories are required to issue a certificate of compliance and ... or b) A letter of certification from the vehicle manufacturer that the car complies with the Euro II emission standard and above (for petrol-driven car) or Euro IV emission standard and above

Ngày tải lên: 07/03/2014, 11:20

23 535 0
Báo cáo khoa học: Identification and characterization of a nuclear receptor subfamily I member in the Platyhelminth Schistosoma mansoni (SmNR1) pot

Báo cáo khoa học: Identification and characterization of a nuclear receptor subfamily I member in the Platyhelminth Schistosoma mansoni (SmNR1) pot

... SmNR1 contains an autonomous transacti-vation function (AF1) in the A⁄ B domain as demonstrated in a yeast one-hybrid assay; it interacts with SmRXR1 in a yeast two-hybrid assay and in a glutathione ... Receptor (RXR) actsas a critical partner and thus plays a central role in a variety of nuclear signaling pathways [3–6] Schistosoma mansoni is a multicellular eukaryotic parasite with a complex life ... Yeast one and two-hybrid assays (A) Yeast one hybrid assay showing that SmNR1 contains an autonomous transactivation function in A ⁄ B domain Individual AH109 yeast colonies obtained from an

Ngày tải lên: 07/03/2014, 11:20

16 548 0
Báo cáo khoa học: Functional expression of olfactory receptors in yeast and development of a bioassay for odorant screening docx

Báo cáo khoa học: Functional expression of olfactory receptors in yeast and development of a bioassay for odorant screening docx

... (5¢-CGTCAAGGAGAAAAAACCCCGGATCT AAAAAATGGAGCGAAGGAACCACAG-3¢) and (5¢-AG CTGCCTGCAGGTCGACTCTAGAGGATCCTAACCAA AAAAAACCCCGGATCTAAAAAATGGAGCAGAAAC CCTGCAGGTCGACTCTAGAGGATCTCAAGCCAGT TGGGGTGTTTGGGCAAC-3¢) ... was obtained from pJH2-SSTR2 by homologous sequence, using primers (5¢-CGTCAAGGAGAAAAAAC CCCGGATCTAAAAAATGGAGCAGAAACTCATCTC TGAAGAGGATCTG-3¢) and (5¢-GCATGCCTGCAGG TCGACTCTAGAGGATCTCAAGCCAGTGACCGCCT ... Trang 8activity By taking advantage of structural and func-tional similarities between yeast and mammalian GPCR signaling pathways, this assay enables the quantitative measurement of receptor activity,

Ngày tải lên: 07/03/2014, 16:20

14 476 0
Báo cáo khoa học: Discovery and characterization of a Coenzyme A disulfide reductase from Pyrococcus horikoshii Implications for the disulfide metabolism of anaerobic hyperthermophiles doc

Báo cáo khoa học: Discovery and characterization of a Coenzyme A disulfide reductase from Pyrococcus horikoshii Implications for the disulfide metabolism of anaerobic hyperthermophiles doc

... (5¢-GGCCTCATGAAGAAAAAGGTCGTCA TAATT-3¢), and TG101 (5¢-GGCCAAGCTTCTAGAAC TTGAGAACCCTAGC-3¢) (for the P horikoshii CoADR), and TG104 (5¢-CGCGCCATGGAAAAGAAAAAGGTA GTCATAA-3¢) and TG105 (5¢-CGCGGTCGACCTAGAA ... blast and tfasta analysis of the phCoADR revealed a significant level of identity to putative NADH oxidases from hyperthermophiles and bacterial NADH oxidases from mesophilic sources (Fig 1) Of ... centrifugation at 15 000 g and Chromatography was performed using an AKTA low-pressure chromatography system (FPLC) from Pharmacia Biotech (Piscataway, NJ) The supernatant was applied to a 25 mL

Ngày tải lên: 07/03/2014, 17:20

12 421 0
Báo cáo khoa học: Purification and properties of a new S-adenosyl-Lmethionine:flavonoid 4¢-O-methyltransferase from carnation (Dianthus caryophyllus L.) pot

Báo cáo khoa học: Purification and properties of a new S-adenosyl-Lmethionine:flavonoid 4¢-O-methyltransferase from carnation (Dianthus caryophyllus L.) pot

... that it consists actually of a unique enzymatic protein Molecular mass and pI determination of F 4¢-OMT The molecular mass of the pure enzyme was calculated both through gel-filtration and PAGE ... for each plant), according to the method of Baayen and Elgersma [13], with a 500-lL drop of Fod conidial suspension at a concentration of 9· 106conidiaÆmL)1; 20 additional plants, inoculated ... at 25C The solvent was a mixture of 0.05M NaPi buffer, pH 3, and acetonitrile (6 : 1, v/v); separation was performed isocratically, at a flow rate of 1 mLÆmin)1, and the volume of injected samples

Ngày tải lên: 08/03/2014, 08:20

10 625 0
Báo cáo Y học: Isolation and characterization of a thioredoxin-dependent peroxidase from Chlamydomonas reinhardtii doc

Báo cáo Y học: Isolation and characterization of a thioredoxin-dependent peroxidase from Chlamydomonas reinhardtii doc

... BASI protein of Brassica, spinach, barley and A thaliana, PR1 of Phaseolus and MHF of A thaliana These proteins belong to the 2Cys-Prx subfamily All plant 2Cys-Prx proteins, except BASI of barley, ... Barley BAS] - ~ MAALQSASRSSAVAFSRQARVAPRVAAS VARRSLVVRA c======~~~~=~~~~~~~~~~~~~~~~~~ DARAEFVARS Arabidopsis BAS] MASVASSTTLISSPSSRVFPAKSSLSSPSVSFLRTLSSPSASASLRSGFARRSSLSSTSRRSFAVKA Pl ... analyses was isolated as described above and separated in a 1.3% agarose/formaldehyde gel The RNA was blotted to a nylon membrane (ZetaProbe, Bio-Rad) by alkaline transfer, UV-crosslinked, and

Ngày tải lên: 08/03/2014, 16:20

11 609 0
presentation and analysis of a multi-dimensional interpolation function for non-uniform data microsphere projection

presentation and analysis of a multi-dimensional interpolation function for non-uniform data microsphere projection

... and methods discussed in this paper are various forms of exact interpolation functions Exact Functional Approximation Inexact Functional Approximation Figure 1.1 Comparison of exact and inexact ... interpolation methods and their implementations Chapter provides a detailed analysis of the Microsphere Projection algorithm In Chapter we present an analysis and comparison of various 1D, 2D and ... PRESENTATION AND ANALYSIS OF A MULTI-DIMENSIONAL INTERPOLATION FUNCTION FOR NON-UNIFORM DATA: MICROSPHERE PROJECTION William Dudziak Thesis Approved: Accepted: Advisor Yingcai Xiao Dean of the...

Ngày tải lên: 30/10/2014, 20:12

157 327 0
A STUDY ON THE DURABILITY AND PERFORMANCE OF PHOTOVOLTAIC MODULES IN THE TROPICS

A STUDY ON THE DURABILITY AND PERFORMANCE OF PHOTOVOLTAIC MODULES IN THE TROPICS

... irradiation and PET/PVF are also good moisture barrier materials An aluminium frame is usually employed to enhance overall mechanical strength of PV module against mechanical and thermo-mechanical ... found a mean degradation rate of 0.8%/year and the majority, 78% of all data, reported a degradation rate of < 1%/year for PV systems/modules in field service Osterwald et al [19] found degradation ... Osterwald et al [19] studied the mechanism of potential-induced degradation and showed that leakage current and the total charge transferred were closely related to power degradation Czanderna and...

Ngày tải lên: 09/09/2015, 08:18

119 658 0
Assessing the Legal and Regulatory Context of a Corridor

Assessing the Legal and Regulatory Context of a Corridor

... Indonesia, Malaysia, the Philippines, Thailand, and Vietnam Brunei Darussalam and Singapore have since joined as contracting parties The agreement establishes and develops a harmonized and integrated ... requires careful analysis and evaluation at the national level This process may call for adaptation of national laws and institutions, the adoption of new technical standards in transport infrastructure ... transport communication in Europe, the Black Sea, the Caucasus, the Caspian Sea, and Asia It aims to regulate the international transport of goods and passengers and transport and transit through...

Ngày tải lên: 25/08/2016, 08:07

20 327 0
The Design and Implementation of a Log-Structured File System

The Design and Implementation of a Log-Structured File System

... have been primarily in the areas of cost and capacity rather than performance There are two components of disk performance: transfer bandwidth and access time Although both of these factors are ... simulates the actions of a cleaner until a threshold number of clean segments is available again In each run the simulator was allowed to run until the write cost stabilized and all coldstart variance ... separate data area of these database systems means that they not need the segment cleaning mechanisms of the Sprite LFS to reclaim log space The space occupied by the log in a database system can...

Ngày tải lên: 12/09/2012, 15:05

15 1,4K 0
w