estrogen receptor as a continuous variable

... between the nucleus and the cytoplasm Whereas cytoplasmic TRADD mediates apoptosis through FADD and caspase-8 activation, nuclear TRADD acts through a mitochondrial apoptosis pathway [28] Our study ... nuclear FADD and its nuclear–cytoplasmic translocation? Functional DISC assembly and activation of caspase-8 is generally considered to be a ‘point of no return’ in the apoptotic signaling cascade ... signals does FADD relocalize to the cytoplasm, promoting CD95–FADD association, which in turn leads to DISC assembly, caspase-8 activation, and apoptotic cell death In addition, nuclear FADD may...

Ngày tải lên: 07/03/2014, 02:20

... Hayashita Y, Osada H, Tatematsu Y, Yamada H, Yanagisawa K, Tomida S, Yatabe Y, Kawahara K, Sekido Y & Takahashi T (2006) A polycistronic microRNA cluster, miR-17-92, is overexpressed in human ... 5¢-GUG GAUAUUGUUGCCAUCA-3¢ The sequences of two siRNAs for ESR1 are as follows: ERa siRNA #2 sense strand 5¢-UCAUCGCAUUCC UUGCAAAdTdT-3¢, antisense strand 5¢- UUUGCAAGGAAUGCGAUGAdTdT-3¢; ERa siRNA ... pancreatic cancer cells [33] Estrogen receptors (mainly ERa and ERb) constitute a group of ligand-activated nuclear receptors that are activated by estrogen Human ERa is a transcription factor that...

Ngày tải lên: 22/03/2014, 21:20

... xylose, N-acetylglucosamine (GlcNAc), and N-acetylgalactosamine (GalNAc) were purchased from Sigma The Re mutant of LPS (E coli D31m4) was from List Biological Laboratory Inc (Campbell, CA, USA) Peptidoglycan ... mgÆmL)1 or BSA at 1.0 mgÆmL)1 (as a control) was used in agglutination of micro-organisms as described previously [21] Binding of 125 I-labeled hemolin to bacteria and yeast Hemolin was labeled with ... bacteria and yeast, and caused aggregation of these micro-organisms Binding of hemolin to the surface of bacteria appears to be due to specific interactions with LPS on Gram-negative bacteria and...

Ngày tải lên: 31/03/2014, 09:20

... nisnetoigna ni KTFAR/βKAC/2kyP esanik enisoryt evitisnes -muiclac fo eloR H arabustaM ,M adanI ,T akasawI ,Y akanaT ,Y ikasabihS ,Y ihcugiroM ,Y imustusT ,K amayuraM ,H ikasaM ,Y awazoN ,Y iroM ,S awasaruM ... inillobaraF ,A onizzumaracS ,I illeracceC ,C odneR ,D ateS alleD ,MA isiolA 96821-66821 ,69 ,9991 ASU icS dacA ltaN corP aimehcsi larberec lacof morf gnitluser egamad tsniaga stcetorp noitibihni esanik ... fo sesaerced htiw deinapmocca yawhtap KRE eht fo noitavitca taht detacidni osla dna ,stneve cixotoruen sesuac APB taht wohs stluser esehT Bκ-FN dna htaed llec lanoruen decudni -APB fo lasrever...

Ngày tải lên: 07/08/2014, 20:23

... gene transfer in the treatment of chronic articular disease Indeed, IL-1Ra gene therapy has demonstrated impressive efficacy in animal models of RA and OA, and a phase I human trial has recently ... triplicate, and each data point represents the mean value ± SD ELISA = enzyme-linked immunosorbent assay; HSF, human synovial fibroblast; IL-1Ra, IL-1 receptor antagonist; PGE2, prostaglandin E2 and ... (Carlsbad, Ca, USA) Recombinant human IL-1β and IL-1Ra were purchased from R&D Systems (Minneapolis, MN, USA) ELISA kits for PGE2 and IL-1Ra were purchased from Dynatech (Ann Arbor, MI, USA) and...

Ngày tải lên: 09/08/2014, 01:23

... obtained was used as a template for real-time quantitative polymerase chain reaction, which was performed with the LC FastStart DNA Master SYBR GreenI® (Roche Diagnostics, Mannheim, Germany) in a LightCycler® ... Freeman GJ: The B7-CD28 superfamily Nat Rev Immunol 2002, 2:116-126 20 Matsuyama T, Yamada A, Kay J, Yamada KM, Akiyama SK, Schlossman SF, Morimoto C: Activation of CD4 cells by fibronectin and anti-CD3 ... stimulated with phorbol 12-myristate 13-acetate (PMA) and ionomycin for 24 h or frozen directly in TriReagent for RNA isolation and real-time polymerase chain reaction, as described in Materials and...

Ngày tải lên: 09/08/2014, 01:23

... chromatin complexes, aberrant DNA methylation, oxidative DNA damage, differential cleavage of DNA, and histone phosphorylation are just a few modifications that may result in increased TLR stimulation ... decreased DNA methyltransferase activity [89] secondary to cellular activation [116] Interestingly, medications that can cause drug-induced lupus (e.g hydralazine and procainamide) are capable ... 34 Tan EM: Antinuclear antibodies: diagnostic markers for autoimmune diseases and probes for cell biology Adv Immunol 1989, 44:93-151 35 Casciola-Rosen LA, Anhalt G, Rosen A: Autoantigens targeted...

Ngày tải lên: 09/08/2014, 07:20

... LQTHFRCQCYLGWGGEQCQWDRRRAAGGASGAWAGSHLTGLLAVAVLAFTWTS LQTHFRCQCYLGWSGEQCQWDHRQAAGGASEAWAGSHLTSLLALAALAFTWTL LQKHFRCQCYLGWGGEQCQRNYKGAAGNASRAWAGSHLTSLLGLVAVALTWTL LQMHFRCHCYLGWGGEQCQWNHKRAAGDASRAWAGAHLASLLGLVAMTLTWTL ... chimeric, and mutant receptors, analyzed the data, and drafted the manuscript All authors read and approved the final manuscript Additional material Additional File "Hyal2 DNA sequences.fasta" Bovine ... LWAESTALFPSVYLEETLASSTHGRNFVSFRVQEALRVADVHHANHALPVYVFTRPTYSR LWAESTALFPSVYLDETLASSRHGRNFVSFRVQEALRVARTHHANHALPVYVFTRPTYSR LWAESTALFPSVYLDETLASSVHSRNFVSFRVREALRVAHTHHANHALPVYVFTRPTYTR LWAESTALFPSVYLDETLASSKHSRNFVSFRVQEALRVAHTHHANHALPVYVFTRPTYTR...

Ngày tải lên: 13/08/2014, 09:21

... maintenance, and spread of malignant tumors.[30] The reduction of EGFR may lead to a failure in downstream signal cascades including PI3-K, RAS-RAF-MAPK P44/P42, and protein kinase C pathway, and ... 5'GGAGCUGCCCAUGAGAAAUdTdT-3' and antisense 5'AUUUCUCAUG GGCAGCUCCdTdT-3' The unrelated nonspecific dsRNAs as control were designed as following: sense 5'-GAACUUCAGGGUCAGCUUG CCdTdT-3' and antisense 5'-GGCAAGCUGACCCUGAAGUUCdTdT3' ... PI3-K, RASRAF-MAPK P44/P42, and protein kinase C signaling pathways EGFR signaling involved in cell growth, angiogenesis, DNA repair, and autocrine growth regulation in NSCLC as well as in a wide...

Ngày tải lên: 14/08/2014, 19:22

... Gram)positive$bacteria$ Porins$ Neisseria$ Lipoarabinomannan$ Mycobacteria$ Flagellin$ Flagellated$bacteria$ CpG$DNA$ Bacteria$and$mycobacteria$ ' Fungus' Zymosan$ Saccharomyces0cerevisiae$ Phospholipomannan$ ... defence! in! phagocytes,!are! vulnerable!to! mycobacterial!diseases! (Casanova! and! Abel,! 2002).! Mutations! in! natural! resistance! associated! macrophage! protein! 1! (Nramp1)! have! been! shown! ... Interferon!regulatory!factor!! LAM! ! ! Lipoarabinomannan! LAMP1! ! Lysosomal!associated!membrane!protein!1!! LPS! ! ! Lipopolysaccharide! MACS! ! ! Magnetic.activated!cell!sorting! manLAM! ! Mannose!capped!LAM!...

Ngày tải lên: 09/09/2015, 18:49

... as vascular endothelial growth factor (VEGF), urokinase plasminogen activator receptor (uPAR), adrenomedullin (ADM), matrix metalloproteinase (MMP2), aldolase A, and enolase Epimedin C decreased ... as MDM2, E6-AP (Shao et al, 2004) and BRCA1 Pure antagonist fulvestrant, also known as ICI 182, 780 and marketed by AstraZeneca as Faslodex, inhibits ERα activity by inducing rapid downregulation ... down-regulators (Howell et al, 2001) such as fulvestrant Although initially classified as competitive antagonists based on their ability to oppose estrogen action in the breast, it has become clear that...

Ngày tải lên: 04/10/2015, 17:05

... CATGGGAGAAAGATGTAGTCTGGGAGAC B CTCTTTCGGGACACAGCATCATAATC B CTCTTTCGGGACACAGCATCATAATC C GAAAGGACAGAGAAGGTGCCAGTTG B TTCGGGACACAGCATCATAA D ATCAAACTGGAGGGAGCAGA B TCAGACAGTGCCAGTGGAAG E GCCAGTGGAAGTGTAAGTTGG ... B TCGGGACACAGCATCATAA F GACACTGACAGGATTTACCATACTGTTGG B TCGGGACACAGCATCATAA G GGTCAAGTGTTCCCGTGATCCTACTG B TCGGGACACAGCATCATAA H CACAGGGAAATGCAGCACAGCTAG B AACCCCGTGTGTCCTTCAG I ACCGTCACTTTCCCTGTGTT ... GAACCTCGAGGCCCTGAATTGCCTTGATATCCAGCTCCCAGGAAC AP2γ in ERBS TCCGGGACAACGCGAACAGGGGCTCTGGAC AP1 in ERBS GCAGGTGAGACTGGCAAAGTTTGACCTGCTGCCGG AP4 in ERBS CTGAGTCAGACAAGCAACCGGGGCAGACGCAGGACAAGG FoxA1...

Ngày tải lên: 05/10/2015, 21:29

... packages có tên samba rpm –qa samba* => liệt kê packages có tên bắt đầu samba rpm –qa | grep samba => liệt kê packages có tên ch a samba rpm –qd samba => liệt kê files tài liệu liên quan đến samba ... a Cao, Q.1, TP.HCM Tel: (84-8) 38244041 – 0989012418 www.athena.edu.vn - Bạn liệt kê danh sách packages cài đặt (Installed packages) danh sách packages dùng cho bạn download (Available packages) ... (configuration) liệt kê tập tin cấu hình package 3/ Gở bỏ package (Erase): Chú ý: Nếu gỡ bỏ package mà package phụ thuộc vào package khác gỡ bỏ ta dùng thêm tuỳ chọn nodeps  Lỗi package samba-3.0.23c-2.rpm...

Ngày tải lên: 13/09/2012, 10:21

Ngày tải lên: 04/10/2012, 10:24

... was stronger among men (OR=3.13) than among women (OR=2.19) (Table 2) Additional analysis treating days of sickness absence during 1990 as a continuous variable showed a clear trend of increase ... Cochran-Armitage trend test was performed in order to test if a gradual increase in sickness absence was associated with increase in risk of disability pension The SAS procedure PROC GENMOD (SAS ... than days of absence per annum decreased from 2.77 to 2.68, and remained significant There was an increased risk of disability pension for people who were smokers at baseline, whereas there was...

Ngày tải lên: 26/10/2012, 10:03

... like to thank Dr Y Watanabe and Dr Y Izumi for collecting the samples, and Ms H Tobe, M Nakamura, and K Sugama for their technical assistance This work was supported financially by a grant from ... 1145-9 Tamura N, Ogawa Y, Chusho H, et al Cardiac fibrosis in mice lacking brain natriuretic peptide Proc Natl Acad Sci USA 2000; 97: 4239-44 Mukoyama M, Nakao K, Saito Y, et al Human brain natriuretic ... 11 Sano M, Kuroi N, Nakayama T, et al The association study of calcitonin -receptor- like receptor gene in essential hypertension Am J Hypertens 2005; 18: 403-8 12 Nakayama T, Soma M, Takahashi...

Ngày tải lên: 26/10/2012, 10:04

... mammalian hosts These animals, usually pigs, act as a transformer or converters; creating a strain that can more readily infect humans Pigs can be infected with both avian and human influenza A ... horses, seals, whales, and many types of birds as well as humans This can be a trans-species virus Type B infects only humans [8] Animals act as reservoirs for this influenza virus and Gelbalt [7] ... as a protease to cleave HA which creates a systemic infection as well [1] Taubenberger [1] reported that this transformation was not observed in the1918 strain, or in strains “captured” in nature...

Ngày tải lên: 02/11/2012, 11:12

... straight away without stopping at a petrol station After having talked and talked and talked, and when I finally managed to dismiss her with fake half-promises and sat back into my car at last ... I knew it wasn’t so A more ominous explanation came to my mind Maybe everything was real, and it was taken for granted that I was dead, just I wasn’t! My brain was still working, and I would ... body Admiration and even something like awe Was he awed because she was dead, by the mystery of death? No, he was awed because in his eyes she was beautiful, a beautiful young woman… For a split...

Ngày tải lên: 07/11/2012, 09:08

... 2005), he also makes a distinction between task-based teaching and tasksupported teaching The task-based teaching occurs when the teaching is based exclusively on meaning-focus tasks, and the task-supported ... functions and language notions are taught to learners at the same time with the assumption that language learning relates to learning formulaic expressions of language as well as learning rules of language ... II.1 A review of language teaching approaches Teaching language has received much focus for the past few decades So many approaches and methods such as Audiolingual Method, Total Physical Response,...

Ngày tải lên: 07/11/2012, 14:44

... pleasantness ratings, the aroma concentration had a similar effect on both age groups in the first tasting session: the heightened aroma sample was rated as less pleasant than the regular aroma sample ... a small food reward after the last evaluation session Samples The sample material was a fermented oat bran product (Yosaw, Bioferme, Finland), which is a cereal-based snack food similar to flavored ... flavor and in overall flavor, and stronger in after-taste than the sample with a regular aroma concentration The heightened aroma concentration caused a slight off-flavor described as ‘artificial’...

Ngày tải lên: 03/04/2013, 21:06