1—retrieve the metadata of a single object

... foundthe faint glowstone rock that marked the mouth of the next passage They walked into the hollow darkuntil they saw the faint light ahead of another glow-stone Sargeth tapped the wall of the passageslowly ... Seek the feed hatch by the haystack, Helm had said, and there was the hay, against the back wall of thestables The structure kept out most of the snow by means of a long sagging roof on pillars ... one last hill Ahead lay a castle where a spydined this night-a spy for the evil wizards bent on seizing the Stag Throne of Athalantar That realmlay not far off to the east The man in the saddle

Ngày tải lên: 31/08/2020, 14:49

... high-performance liquid chromatography The amount of 7 α-OH-DHEA is expressed as the percentage [ 3 H]-7 α-OH-DHEA of the total amount of [ 3 H]-label measured Results are expressed as the mean ± standard ... α-OH-DHEA and 3H-labelled DHEA were measured using high-per-formance liquid chromatography The amount of 7α-OH-DHEA is expressed as the percentage of 3H-labelled 7 α-OH-DHEA of the total amount of ... Devauchelle V, Martin A, Baron D, et al.: Ability of the American College of Rheumatology 1987 criteria to predict rheumatoid arthritis in patients with early arthritis and classifi-cation of these

Ngày tải lên: 09/08/2014, 07:20

... Masaoka III Masaoka IV a Data are presented as mean ± SD unless otherwise indicated. b Myasthenia gravis Table 2: Clinical features of different thymoma classified according Masaoka Stage a Masaoka ... Okumura M, Ohta M, Tateyama H, Nakagawa K, Matsumura A, Maeda H, Tada H, Eimoto T, Matsuda H, Masaoka A: The World Health Organization histologic classification system reflects the oncologic behavior ... prognosis Although the presence of a capsula is of strong significance in the univariate analysis, it failed in the multivariate analysis due to its correlation with clinical Masaoka stage Masaoka stage

Ngày tải lên: 10/08/2014, 10:20

... Amsterdam, Amsterdam, The Netherlands and 2 Department of Paediatric Oncology, Emma Children Hospital, Academic Medical Center of the University of Amsterdam, Amsterdam, The Netherlands Email: Rienk ... Surprisingly, replicaconcentra-tion of the minimized rtTAΔ6A and rtTAΔ6B variants is significantly faster than that of the parental HIV-rtTA virus and even faster than the wild type LAI virus Similar results ... -rtTAΔ7 A rtTAΔ7 B LAI MEPVDPRLEPWKHPGSQPKTACTTCYCKKCCFHCQVCFTTKALGISYGRKKRRQRRRPPQGSQTHQVSLSK NL4-3 N M AH.N A HIV-rtTA A rtTAΔ6A N M AH.N A rtTAΔ7A A M AH.N A rtTAΔ6B N M AH.N A rtTAΔ7B A

Ngày tải lên: 13/08/2014, 09:20

... ever, the diagnosis of FNH could not be achieved with cer- tainty, due to the absence of all the imaging criteria and, above all, the absence of a central scar. The diagnosis of adenoma could ... stages of FNH for- mation there are various features: a) at the border, there were abnormal portal tracts, which were more fibrotic, and there was also an absence of portal veins and ducts and arterial ... (upper part). The upper micrograph (A) displays GS staining, and the lower micrograph (B) shows H&E staining. The GS stained area is wider in the nodular part than in the non- nodular part. The

Ngày tải lên: 13/08/2014, 13:20

... Papageorgiou and AnnaSidera for their continual support and the great summers I spent with them I thank my grandparents Panagiota and Charalambos Konstantinou, MariaZeniou and my spiritual father Michalis ... than afamily to me here in Tucson: Nakul Chitnis; Luis Garcia-Naranjo; Adam Spiegler;Rosangela Sviercoski; Gabriella, Eleni, Alexandros and Pavlos Michaelidou; AntonioColangelo and Mariagrazia ... Trang 1byPanagiota Savva KonstantinouA Dissertation Submitted to the Faculty of theDEPARTMENT OF MATHEMATICS In Partial Fulfillment of the Requirements For the Degree ofDOCTOR OF PHILOSOPHY

Ngày tải lên: 13/11/2014, 09:14

... IEL-mediated epithelial damage Another source of IL 15 are epithelial and dendritic cells after contact with prolamin To sum up, the contact of prolamin with the epithelial layer activates the innate ... Coo-massie Blue assay or Bicinchoninic acid assay (Sigma-Al-drich, Vienna, Austria) Bovine serum albumin (BSA) was used as a standard To stay in the linear range of the de-tector (Genesys 20, Thermo Scientific, ... Impurities 4 The other peaks in the chromatogram are buffer peaks Trang 7Filtration LMW Calibration Kit, GE Healthcare, Vienna,Austria) Recorded chromatographic data at 280 nm were analyzed using

Ngày tải lên: 16/05/2020, 19:58

... institutional clinical data base on breast cancer is operated by DATA MANAGEMENT AND ANALYSIS CENTER (DMAC), approved for its data management skills as data processing centers by INCa (French National ... non-comparatretrospect-ive nature, the lack of central and ad hoc review of bio-logical variables, the relatively high number of missing data for analysis of molecular subtypes (n = 163), notably the ... or aromatase inhibitors) From 2005, patients with HER2-positive BC were offered adjuvant trastuzumab after completion of radiotherapy Statistical analyses The primary objective of this study was

Ngày tải lên: 22/09/2020, 23:54

... It can be inferred from the second paragraph of the reading passage that there has been ……… A a change in the parents’ attitude towards the class B a lot of protest from the parents against the ... with a partner Look at the Braille Alphabet Then work out the message that follows While you read Read the passage and then do the tasks that follow A TEACHER IN A SPECIAL CLASS Like other ... Christmas and the mall was crowded with shoppers. 5 If two people speak the same language, they usually have similar attitudes and opinions  Task 2 Work in pair Read the small talks again and

Ngày tải lên: 12/04/2021, 19:38

... _ Summarises the main points of the lesson _ Learn by heart the new words the coversation again and fill the blanks.Play the tape more than once Asks Ss to ask & answer about Sally Calls n ... class Pair workWhole class Trang 283’ TASK3:Write a paragraph about your partner’s parent Then ask him/ her to read the paragraph and check whether the information is correct. His name is Tran ... is the name of the club?Who are the members of the club? Where do they come from? How many are there? How many photographs are on display? What are their photographs about? What does their passion

Ngày tải lên: 18/04/2021, 00:42

... Ba : Can you play on Friday ? Nam : Yes, I can. Ba : All right See you at seven. Ba : Bye. Ba : Come and play basketball , Nam. Trang 14Ba : Come and play basketball , Nam.Nam : I’m sorry ... have a spare one ? Ba: Yes, I do. Nam: Can I borrow it ? Ba: Sure Here you are. Nam: Thanks Ba: OK Let’s go. ought to table tennis paddlestable tennis paddles Trang 11Ba: Nam ?Nam: Ba: That’s ... Ask and answer the questions. Go 2 Trang 13Ba : Come and play basketball, Nam. Nam : I’m sorry I don’t think I can. Ba : That’s too bad Why not ? Nam : Well, I should clean my room Ba : Can

Ngày tải lên: 20/04/2021, 14:43

... aspects of the source or target languages.There are many definitions about translation: “Translation is the expression in another language (target language) of what has been expressed in one language ... the replacement of textual material in one language (source language) by equivalent textual material in another language (target language)” ( J.C Catford) [1] “Translation is a process of conveying ... negative programming regarding my financial and intellectual capabilities, I persevered and, against the odds of having average college grades, was accepted into a medical program.Physician Assistant

Ngày tải lên: 29/03/2022, 16:09

... beautiful Black woman” is an antithesis to thesis that states “Blacks are not beautiful” (1.0) Antitheses are indicated in the form of T.A, where T indicates the number of the thesis and A the number ... when the narrator explicitly rep-resented a particular thesis and antithesis in opposition to each other (e.g., “there was a side of me that didn’t actually want to admit that she was rather ... supremacist through the process of forging relationships with Afri-can AmeriAfri-cans, including an AfriAfri-can AmeriAfri-can female whom he would later wed The narra-tor’s developmental narrative

Ngày tải lên: 12/10/2022, 08:52

... Trang 1Evaluation of the allowable axial bearing capacity of a single pile subjected to machine vibration by numerical analysis Ik Soo Ha1 and Jin‑Tae Han2* Background Recently, as the demand of ... of author information is available at the end of the article Trang 2model for evaluating the resonance phenomenon of the vibration machine by vibration load rather than the evaluation of the ... that the sum of static and dynamic loads is designed in less than 75% of the allowable bearing capacity when estimating the axial bearing capacity of a pile foundation, and if the machine manufacturer

Ngày tải lên: 24/11/2022, 17:56

... tran-scripts of each gene in each individual We used protein abundance data calculated as relative values to a SILAC internal standard sample (i.e., log2 sample standard ) produced by quantitative ... by a National Research Foundation of Korea (NRF) grant funded by the Korean government (MSIT) [Grant No NRF-2018R1A2B6004867]. Availability of data and materials The data used in this study are ... individual in at least two lanes of the Illumina Genome Analyzer 2 platform and mapped reads to the human genome using MAQ v0.6.8 They had a median coverage of 8.6 million mapped reads per sample We

Ngày tải lên: 30/01/2023, 20:48

... – Advantages • Can carry up to three times the amount of data as TDMA • Transmissions are much harder to eavesdrop on • A would-be eavesdropper must also know the exact chip in which the transmission ... receiving the signal • Attenuation – A loss of signal strength • Multipath distortion – As a radio signal is transmitted, the electromagnetic waves spread out 24 Signal Strength (continued) 25 Radio ... Communications Understanding Radio Frequency Communications Objectives • List the components of a radio system • Describe how different factors affect the design of a radio system • Explain the radio

Ngày tải lên: 13/09/2012, 10:52

... warranty obligation between the involved parties It can be seen as an obvious offer of the Seller to the Company in case of any goods damage arising out of the Company’s obligations such as damage ... days after of the buyer’s advice ARTICLE 8: ARBITRATION During the performance of the contract, if any dispute arises, the parties shall discuss to find solution in an amicable way If the parties ... fail to read an agreement in such way, the dispute shall be brought to the Central of the International Arbitration under Chamber of Commerce and industry of Vietnam whose award shall be final

Ngày tải lên: 18/04/2013, 08:57

... top of the tank It is originated from the fact that, after gaining heat from the solar radiation, the tank wall heats a thin vertical layer of water along the tank wall Part of this heat is then ... initial and mass-weighted average temperatures of water; with all the values, apart from the mass-mass-weighted average temperature, are the same in both studies Accordingly, a parameter equals to the ... actual performance of a large capacity integrated collector storage solar water heater in the shape of a right angle prism-shaped tank covered with glass during several months of the year The heat

Ngày tải lên: 05/09/2013, 15:28

... support to MFIs amongst lower income populations The data was tabulated and analyzed through qualitative analysis of the gathered data, which reveal the behaviors and decision making patterns in lower ... including educational, communal, cultural, political and economic facets The questionnaire also evaluated the level of awareness about MFIs, availability and accessibility to MFIs, and impact of Government ... Bangladesh, Zambia and Bolivia, it can be inferred that such initiatives can also encourage small and medium sized profitable business establishments in the rural and remote areas of Pakistan

Ngày tải lên: 06/09/2013, 05:48

... close of the performance was overjoyed at his invitation to accompany him to a nearby café I noticed that the attention of those in the café was drawn toward him as we entered and that the management ... suffer all sorts of lack, misery and unhappiness when such inferior creatures as the beasts of the field, the birds of the air and the fish of the sea are bountifully supplied For any man, no matter ... scales are balanced against them Here and there, among the masses, we find an occasional outstanding figure who has achieved greatness or success and he is erroneously singled out as lucky or as

Ngày tải lên: 15/12/2013, 06:15