o'reilly - linux command directory

O'Reilly Network: Linux Command Directory: agetty [March 15, 2002]Sponsored by: Search | Newsletter | Conference | Tech Jobs O'Reilly's Emerging Technology Conference: May 13-16, 2002 T

Trang 1

O'Reilly Network: Directory of Linux Commands [March 15, 2002]

Sponsored by:

Search | Newsletter | Conference | Tech Jobs

O'Reilly's Emerging Technology Conference: May 13-16, 2002

This directory of Linux commands is from Linux in a Nutshell, 3rd Edition Click on any of the 379 commands below to get a description and list of available options All links in the command summaries point to the online version of the book on Safari Tech Books Online.

Buy it now Read it online

[A] [B] [C] [D] [E] [F] [G] [H] [I] [J] [K] [L] [M]

[N] [O] [P] [Q] [R] [S] [T] [U] [V] [W] [X] [Y] [Z]

A

agettyapmdaproposararcharpasatatqatrm

grepgroffgroupaddgroupdelgroupmodgroupsgrpckgrpconvgsgunzipgzexegzip

H

loggerloginlognamelogrotatelooklpclpdlpqlprlprmlpstatlptestls

pcnfsdperlpidofpingpop2dpop3dportmappowerdpppdprpraliasesprintenvprintf

rwhod

S

scriptsedsendmailsetfdprmsetsidshsharshowmountshutdownsizeslattach

tunelp

U

ulumountunameuncompressunexpanduniqunsharupdateuptimeuseradduserdel

znew

Sponsored by:

http://www.onlamp.com/linux/cmd/ (1 of 5) [29/03/02 19:08:41]

Trang 2

C

c++

calcardctlcardmgrcatcccppcfdiskchattrchfnchgrpchmodchownchpasswdchrootchshcksumclearcmpcolcolcrtcolrmcolumncommcompress

domainnamedosfsckdudumpe2fsdumpkeys

E

e2fsckechoegrepemacsenvetagsexexpandexpr

F

falsefdformatfdiskfetchmailfgrepfilefindfingerfingerdflexfmtfoldformailfreefsckfsck.minixftp

ftpdfuser

G

g++

haltheadhosthostidhostnamehwclock

I

icmpinfoididentdifconfigimakeimapdinetdinfoinitinsmodinstallipchainsipchains-restoreipchains-saveipfwadmiptablesiptables-restoreiptables-saveispell

J

join

K

kbd_modekbdratekerneldkill

lsattrlsmod

M

m4mailmailqmailstatsmakemakedbmmakemapmanmanpathmergemesgmimencodemkdirmke2fsmkfsmkfs.minixmklost+foundmkraidmkswapmodprobemoremountmountdmv

N

namednameinetdatenetstatnewgrpnewusersnfsdnicenm

pspsupdatepwckpwconvpwd

Q

quota

R

raidstartramsizeranlibrarprcprdaterdevrdistrdistdrebootreniceresetrevrexecdrloginrlogindrmrmailrmdirrmmodrootflagsrouteroutedrpcgenrpcinforpmrshrshdrstat

sleepsortsplitstatstracestrfilestringsstripsttysusumswapdevswapoffswaponsyncsysklogdsyslogdsystat

T

tactailtalktalkdtartcpdtcpdchktcpdmatchtcshteetelinittelnettelnetdtesttftptftpdtloadtop

usermodusersusleepuudecodeuuencode

V

vacationvividmode

W

wwallwcwhatiswhereiswhichwhowhoamiwrite

X

xargs

Y

yaccyesypbindypcatypchfnypchshypinitypmatchyppasswdyppasswddyppollyppushypservypsetypwhichhttp://www.onlamp.com/linux/cmd/ (2 of 5) [29/03/02 19:08:41]

Trang 3

gatedgawkgccgdbgdcgetkeycodesgettygprof

killallkillall5klogdksyms

L

lastlogldldconfiglddlesslnlocatelockfile

nohupnslookup

O P

passwdpastepatchpathchk

partsrunlevelruptimerusersrwallrwho

run-touchtrtraceroutetrofftruetune2fs

ypxfr

Z

zcatzcmpzdiffzdumpzforcezgrepziczmore

Trang 4

Trang 5

Trang 6

O'Reilly Network: Linux Command Directory: agetty [March 15, 2002]

Sponsored by:

This directory of Linux commands is from Linux in a Nutshell, 3rd Edition Click on any of the 379 commands below to get a description and list of available options All links in the command summaries point to the online version

of the book on Safari Tech Books Online

Buy it nowRead it online

agetty [options] port baudrate [term]

System administration command The Linux version of getty Set terminal type, modes, speed, and line discipline agetty is invoked by init It is the second process in the series init-getty-login-shell, which ultimately connects a user with the Linux system agetty reads the user's login name and invokes the login command with the user's name as an argument While reading the name, agetty

attempts to adapt the system to the speed and type of device being used

You must specify a port, which agetty will search for in the /dev directory You

may use -, in which case agetty reads from standard input You must also

specify baudrate, which may be a comma-separated list of rates, through which

agetty will step Optionally, you may specify the term, which is used to

override the TERM environment variable

Specify that agetty should exit if the open on the line succeeds and there

is no response to the login prompt in timeout seconds.

-L

Sponsored by:

http://www.onlamp.com/linux/cmd/a/agetty.html (1 of 3) [29/03/02 19:08:45]

Trang 7

Trang 8

Trang 9

O'Reilly Network: Linux Command Directory: apmd [March 15, 2002]

Sponsored by:

apmd [options]

System administration command apmd handles events reported by the

Advanced Power Management BIOS driver The driver reports on battery level

and requests to enter sleep or suspend mode apmd will log any reports it gets via syslogd and take steps to make sure that basic sleep and suspend requests are handled gracefully You can fine-tune the behavior of apmd by specifying

an apmd_proxy command to run when it receives an event.

Options

-c n, check n

Set the number of seconds to wait for an event before rechecking the power level Default is to wait indefinitely Setting this causes the battery levels to be checked more frequently

-P command, apmd_prxy command

Specify the apmd_proxy command to run when APM driver events are

reported This is generally a shell script The command will be invoked

with parameters indicating what kind of event was received The parameters are in the next list

-p n, percentage n

Log information whenever the power changes by n percent The default

is 5 Values greater than 100 will disable logging of power changes

Trang 10

Log a warning at ALERT level when the battery charge drops below n

percent The default is 10 Negative values disable low battery level warnings

Invoked when the daemon stops

suspend [ system | user ]

Invoked when a suspend request has been made The second parameter indicates whether the request was made by the system or by the user

standby [ system | user ]

Invoked when a standby request has been made The second parameter indicates whether the request was made by the system or by the user

resume [ suspend | standby | critical ]

Invoked when the system resumes normal operation The second parameter indicates the mode the system was in before resuming

(critical suspends indicate an emergency shutdown After a critical suspend the system may be unstable and you can use the resume

command to help you recover from the suspension

Trang 11

XML Return to: Alphabetical Directory of Linux Commands

For problems or assistance with this site, email help@oreillynet.com

http://www.onlamp.com/linux/cmd/a/apmd.html (3 of 3) [29/03/02 19:08:54]

Trang 12

O'Reilly Network: Linux Command Directory: apropos [March 15, 2002]

Sponsored by:

apropos string

Search the short manual page descriptions in the whatis database for

occurrences of each string and display the result on the standard output Like

whatis, except that it searches for strings instead of words Equivalent to man k.

-Return to: Alphabetical Directory of Linux Commands

Sponsored by:

http://www.onlamp.com/linux/cmd/a/apropos.html (1 of 3) [29/03/02 19:08:59]

Trang 13

Trang 14

Trang 15

O'Reilly Network: Linux Command Directory: ar [March 15, 2002]

Sponsored by:

ar [-V] key [args] [posname] archive [files]

Maintain a group of files that are combined into a file archive Used most

commonly to create and update library files as used by the link editor (ld) Only

one key letter may be used, but each can be combined with additional args (with no separations between) posname is the name of a file in archive When moving or replacing files, you can specify that they be placed before or after

posname -V prints the version number of ar on standard error

Trang 16

Trang 17

Trang 18

O'Reilly Network: Linux Command Directory: arch [March 15, 2002]

Sponsored by:

arch

Print machine architecture type to standard output Equivalent to uname -m.

Return to: Alphabetical Directory of Linux Commands

Sponsored by:

http://www.onlamp.com/linux/cmd/a/arch.html (1 of 3) [29/03/02 19:09:11]

Trang 19

Trang 20

Trang 21

O'Reilly Network: Linux Command Directory: arp [March 15, 2002]

Sponsored by:

Search for type entries when examining the ARP cache type must be

ether (Ethernet) or ax25 (AX.25 packet radio); ether is the default.

Add the entry host hardware-address, where ether class addresses are 6

hexadecimal bytes, colon-separated

-f file

Read entries from file and add them.

Sponsored by:

http://www.onlamp.com/linux/cmd/a/arp.html (1 of 3) [29/03/02 19:09:17]

Trang 22

Trang 23

Trang 24

O'Reilly Network: Linux Command Directory: as [March 15, 2002]

Sponsored by:

as [options] files

Generate an object file from each specified assembly language source file

Object files have the same root name as source files but replace the s suffix with o There may be some additional system-specific options.

Options

[ | files]

Read input files from standard input, or from files if the pipe is used.

-a[dhlns][=file]

With only the -a option, list source code, assembler listing, and symbol

table The other options specify additional things to list or omit:

Trang 25

Trang 26

Trang 27

O'Reilly Network: Linux Command Directory: at [March 15, 2002]

Sponsored by:

at [options] time

Execute commands at a specified time and optional date The commands are

read from standard input or from a file (See also batch.) End input with EOF

time can be formed either as a numeric hour (with optional minutes and

modifiers) or as a keyword It can contain an optional date, formed as a month and date, a day of the week, or a special keyword (today or tomorrow) An

increment can also be specified

The at command can always be issued by a privileged user Other users must be

listed in the file /etc/at.allow if it exists; otherwise, they must not be listed in

/etc/at.deny If neither file exists, only a privileged user can issue the command.

Trang 28

Place job in queue denoted by letter, where letter is any single letter

from a-z or A-Z Default queue is a (The batch queue defaults to b.)

Higher-lettered queues run at a lower priority

omitted if the format is h, hh, or hhmm; (e.g., valid times are 5, 5:30,

0530, 19:45) If modifier am or pm is added, time is based on a 12-hour

clock If the keyword zulu is added, times correspond to Greenwich

Mean Time

midnight | noon | teatime | now

Use any one of these keywords in place of a numeric time teatime

translates to 4:00 p.m.; now must be followed by an increment.

Date

month num[, year]

month is one of the 12 months, spelled out or abbreviated to its first

three letters; num is the calendar date of the month; year is the four-digit

year If the given month occurs before the current month, at schedules

that month next year

day

One of the seven days of the week, spelled out or abbreviated to its first three letters

today | tomorrow

Indicate the current day or the next day If date is omitted, at schedules

today when the specified time occurs later than the current time;

otherwise, at schedules tomorrow.

Increment

Supply a numeric increment if you want to specify an execution time or day

relative to the current time The number should precede any of the keywords

minute, hour, day, week, month, or year (or their plural forms) The keyword next can be used as a synonym of + 1.

Trang 29

XML Return to: Alphabetical Directory of Linux Commands

For problems or assistance with this site, email help@oreillynet.com

http://www.onlamp.com/linux/cmd/a/at.html (3 of 3) [29/03/02 19:09:34]

Trang 30

O'Reilly Network: Linux Command Directory: atq [March 15, 2002]

Sponsored by:

atq [options]

List the user's pending jobs, unless the user is a privileged user; in that case,

everybody's jobs are listed Same as at -l.

Print the version number

Sponsored by:

http://www.onlamp.com/linux/cmd/a/atq.html (1 of 3) [29/03/02 19:09:42]

Trang 31

Trang 32

Trang 33

O'Reilly Network: Linux Command Directory: atrm [March 15, 2002]

Sponsored by:

atrm [options] job [job ]

Delete jobs that have been queued for future execution Same as at -d.

Options

-q queue

Remove job from the specified queue

-V

Print the version number and then exit

Sponsored by:

http://www.onlamp.com/linux/cmd/a/atrm.html (1 of 3) [29/03/02 19:09:50]

Trang 34

Trang 35

Trang 36

O'Reilly Network: Linux Command Directory: badblocks [March 15, 2002]

Sponsored by:

badblocks [options] device block-count

System administration command Search device for bad blocks You must specify the number of blocks on the device (block-count)

Test by writing to each block and then reading back from it

Sponsored by:

http://www.onlamp.com/linux/cmd/b/badblocks.html (1 of 3) [29/03/02 19:09:56]

Trang 37

Trang 38

Trang 39

O'Reilly Network: Linux Command Directory: cut [March 15, 2002]

Sponsored by:

cut options [files]

Cut out selected columns or fields from one or more files In the following options, list is a sequence of integers Use a comma between separate values

and a hyphen to specify a range (e.g., 1-10,15,20 or 50-) See also paste and

join.

Options

-b list, bytes list

Specify list of positions; only bytes in these positions will be printed.

-c list, characters list

Cut the column positions identified in list.

-d c, delimiter c

Use with -f to specify field delimiter as character c (default is tab);

special characters (e.g., a space) must be quoted

-f list, fields list

Cut the fields identified in list.

Use string as the output delimiter By default, the output delimiter is the

same as the input delimiter

Sponsored by:

http://www.onlamp.com/linux/cmd/c/cut.html (1 of 3) [29/03/02 19:10:02]

Trang 40

O'Reilly Network: Linux Command Directory: cut [March 15, 2002]

Cut characters in the fourth column of file, and paste them back as the first

column in the same file:

cut -c4 file | paste - file

http://www.onlamp.com/linux/cmd/c/cut.html (2 of 3) [29/03/02 19:10:02]

Tiêu đề	Directory of Linux Commands
Trường học	University of O'Reilly
Chuyên ngành	Computer Science
Thể loại	tài liệu hướng dẫn
Năm xuất bản	2002
Thành phố	Unknown

Định dạng
Số trang	1.255
Dung lượng	10,39 MB