A Localisation and Navigation System for anAutonomous Wheel Loader
... wheel loaders, haulers, crawling and wheeled excavators, motor graders, demolition equipment and pipelayers 1.1.3 Wheel Loaders A wheel loader is a versatile vehicle able to perform a wide variety ... dirt roads and paved roads with multiple lanes The probably most recognised AGVs today are the participators of the DARPA Grand Challenge held in 2004 and 2005, and the D...
Ngày tải lên: 23/02/2017, 22:46
... calization, and visualization tool for microblog messages It can serve as a real-time sentiment detector or an interactive microblog audiovisual presentation system Technically, we integrate ... We also integrate the sentiment-detection system with a real-time rule-based harmonic music and animation generator to display streams of messages in an audiovisual format Co...
Ngày tải lên: 20/02/2014, 05:20
... task, it was necessary to design and develop a novel technology that could directly interface a range of sensor elements and to provide a reliable and low cost method of capturing and storing the ... order to provide automatic interpretation of the output pulse train and to offer a direct readout in the numerical units desired In the case of PC-based...
Ngày tải lên: 22/06/2014, 01:20
Báo cáo hóa học: " Design and Realization of a New Signal Security System for Multimedia Data Transmission" ppt
... This data- processing rate is fast enough for realtime data protection in multimedia data transmission applications The proposed signal security system is suitable for both software and hardware ... updating period of the parameters of µ and x(0) could be based on the basic unit of video frame or audio frame in representing the multimedia data A New Signal...
Ngày tải lên: 23/06/2014, 01:20
Báo cáo khoa học: "A new data processing system for root growth and ramification analysis: description of methods" pot
... expression of the ’hierarchic’ position of each root in the ramified system and speeds up the computing of growth and ramification parameters Table I shows the final data structure of the simplified ... structure and allows a detailed analysis of growth and branching patterns References Belgrand M., Dreyer E., Joannes H., Velter C & Scuiller (1987) A semi-automat...
Ngày tải lên: 09/08/2014, 02:21
PERFORMANCE OF A COMBINED CONSTRUCTED WETLAND SYSTEM FOR TREATING VILLAGE SEWAGE IN LAKE DIANCHI VALLEY
... adopted to treat a typical village sewage There is the long rain season in local place always accompanied with strong storms at the beginning The stormwater runoff not only brings the large amounts ... or float method RESULTS AND DISCUSSION Removal performance of constructed wetland system for village sewage The COD Profiles of influent and effluent, as well as corre...
Ngày tải lên: 05/09/2013, 08:40
Evaluation of Dredged Sediment as a Silt and Clay Source for Artificial Tidal Flats
... in artificial tidal flats in Japan, a growth test of R philippinarum was also carried out in DS mixtures MATERIALS AND METHODS Artificial tidal flats in real seashore Five artificial tidal flats ... observed variation in the macrobenthos population in the artificial tidal flats and the natural tidal flat The abundance of macrobenthos in the artificial ti...
Ngày tải lên: 05/09/2013, 09:38
A distributed decision support system for building evacuation 2009
... translated in a full knowledge of the building graph and a calculation of the shortest paths by using Dijkstra’s algorithm An evacuee becomes aware of a hazardous area when it reaches a location ... hazard A low value indicates that the system has succeeded in directing the evacuees along safe paths, avoiding the hazardous locations • Percentage of fatally injured evacuees This...
Ngày tải lên: 07/12/2013, 11:41
PROBE–A multicriteria decision support system for portfolio robustness evaluation
... approach, and Logical Decisions Portfolio implements the two approaches Section introduces PROBE Portfolio Robustness Evaluation, a new decision support system for multicriteria portfolio analysis ... 2041-4668 (Online) PROBE A multicriteria decision support system for portfolio robustness evaluation João Carlos Lourenço1 and Carlos A Bana e Costa1,2 CEG-IST...
Ngày tải lên: 07/12/2013, 11:41
Tài liệu Designing a Domain and OU Structure for Group Policy docx
Ngày tải lên: 24/01/2014, 19:20
Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc
... T thermophilus E coli A pernix 277 277 283 TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... (Osaka, Japan) Emulgen 911 was a gift from Kao Chemical (Tokyo, Japan) NADPH, NADH and NADP+ were purchased from Oriental Yeast (Tokyo, Japan) a- Cyano-4-hydroxycinnamic ac...
Ngày tải lên: 18/02/2014, 08:20
Tài liệu Báo cáo khoa học: "Word representations: A simple and general method for semi-supervised learning" doc
... more general than that of Ando and Zhang (2005) and Suzuki and Isozaki (2008) Their methods dictate a particular choice of model and training regime and could not, for instance, be used with an ... 216 documents) We also evaluated on an out-of-domain (OOD) dataset, the MUC7 formal run (59K words) MUC7 has a different annotation standard than the CoNLL03 data It has several NE...
Ngày tải lên: 20/02/2014, 04:20