Characterization of pin1 function in zebrafish development

Characterization of pin1 function in zebrafish development

Characterization of pin1 function in zebrafish development

... 1.1.3.1 Pin1 function in M phase 1.1.3.2 Pin1 function in G1 and S phase 1.1.3.3 Pin1 function in oncogenesis .9 1.1.4 Pin1 function in apoptosis 10 1.1.5 Pin1 function in ... reduction of zPin1 expression in zPin1 morphant embryos 79 Figure 3.8 Developmental delay in zPin1 morphant embryos 82 Figure 3.9 Neurogenin1 staining of the wild type embryos and c...

Ngày tải lên: 12/09/2015, 09:55

166 224 0
Characterization of wip1 function in tumourigenesis

Characterization of wip1 function in tumourigenesis

... signaling Introduction 1.2 The function of Wip1 1.2.1 The characterization of Wip1 In 1997, PP2Cδ was initially identified by Fiscella and colleagues as Wip1, wild-type p53-induced phosphatase 1, in ... formation in the presence of the ApcMin mutation, suggesting that Wip1 is critical in regulating ApcMin-driven polyposis (Demidov et al., 2007a) In Wip1- deficient...

Ngày tải lên: 12/09/2015, 09:59

194 226 0
Functional characterization of giant killer in flower development and meristem regulation in arabidopsis thaliana 1

Functional characterization of giant killer in flower development and meristem regulation in arabidopsis thaliana 1

... ………………………………….4 1. 3 Regulation of flower development in Arabidopsis thaliana ……………………….9 1. 4 Patterning and differentiation of lateral organs in Arabidopsis thaliana 13 1. 4 .1 The patterning of lateral ... Results…………………………………………………………………………… 11 6 5.2 .1 Protein sequence alignment for GIK1 and GIK2.…………………… 11 6 5.2.2 Expression of GIK2 in inflorescence...

Ngày tải lên: 14/09/2015, 08:46

16 259 0
Functional characterization of giant killer in flower development and meristem regulation in arabidopsis thaliana 2

Functional characterization of giant killer in flower development and meristem regulation in arabidopsis thaliana 2

... reported to be involved in the regulation of flowering and hypocotyl elongation (Xiao et al., 20 09) Overexpression of AHL 22 effectively delays the flowering process in Arabidopsis In spite of these ... transforms the inflorescence meristem into a terminal flower Figure 1: Inflorescence meristem and floral meristem in Arabidopsis thaliana Upper panel: sche...

Ngày tải lên: 14/09/2015, 08:46

152 481 0
Functional characterization of HGF and its receptor c met in zebrafish development

Functional characterization of HGF and its receptor c met in zebrafish development

... paracrine signaling in liver development The coexpression of hgfa and c- met in pectoral fin, hgfb and c- met in proneprhic duct also indicate their paracrine signaling in the development of these ... Characterizing HGF and its receptor c- met s role in zebrafish development (Manuscript in preparation) v LIST OF FIGURES Fig.1.1 Schematic represent...

Ngày tải lên: 12/09/2015, 08:18

220 499 0
báo cáo khoa học: " Identification and characterization of flowering genes in kiwifruit: sequence conservation and role in kiwifruit flower development" ppt

báo cáo khoa học: " Identification and characterization of flowering genes in kiwifruit: sequence conservation and role in kiwifruit flower development" ppt

... Page of 15 Figure Expression profiles of Actinidia flowering genes in mature plant organs Real-time RT-PCR analysis of the Actinidia flowering genes in the root, stem internode, leaf, flower and ... Figure Expression profiles of Actinidia flowering genes in normal and aberrant flowers Real-time RT-PCR analysis of the Actinidia flowering genes in the lea...

Ngày tải lên: 11/08/2014, 11:22

16 389 0
Characterization of the function of tight junction proteins in transgenic mice

Characterization of the function of tight junction proteins in transgenic mice

... drawing of the TJ proteins TJ proteins consist of TM proteins and plaque proteins that link TM proteins to the cytoskeleton (Johnson LG 2005) 16 TM proteins of TJ The three most common TM proteins ... cytoskeleton proteins Some scaffolding TJ proteins lacking PDZ domains such as cingulin can also link integral proteins to the actin cytoskeleton, whereas other...

Ngày tải lên: 11/09/2015, 16:04

173 400 0
Roles of rho small GTPase in zebrafish development

Roles of rho small GTPase in zebrafish development

... proteins of RhoA have been discovered, including protein kinases (protein kinase N/protein kinase C-related kinase (PKN/ PRK1), PRK2, citron kinase), non-kinases (Rhophilin, Rhotekin, Kinectin), ... profilin, an actin monomer-binding protein, through their FH domain [Sohn et al 1994] This interaction allows them to bind to the barbed ends of actin filaments, which antagonizes the binding...

Ngày tải lên: 12/09/2015, 08:19

167 213 0
Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 1

Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 1

... ANALYSIS OF REGULATOR OF G- PROTEIN SIGNALING (RGS) FUNCTION IN GROWTH, DEVELOPMENT AND PATHOGENICITY OF MAGNAPORTHE GRISEA HAO LIU A THESIS SUBMITTED FOR THE DEGREE OF DOCTOR OF PHILOSOPHY ... yeast…………………………………………… 22 1. 2.2.3 G proteins in mammals………………………………………… 23 1. 2.3 Desensitization of G protein Signaling ………………………… …… 24 1. 2.3 .1...

Ngày tải lên: 14/09/2015, 09:13

220 230 0
Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 2

Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 2

... HPH1 RGS1 Figure 21 A rgs1D WT Rgs1 OP Complemented B WT rgs1D Complemented Rgs1 OP _ Figure 22 Inductive Non-inductive _ Figure 23 WT rgs1D Complemented Figure 24 Figure 25 Figure 26 Rgs1 MG00990 ... FlbA Sst2 467 27 2 479 466 QQDRSHIQQFPGCQVFQPTKHAIYHMTSKGKDMINGSVPRGRASEGDATHSATHRHG-VA QQDRAYTAQYPGSQLFQPTKHSIYQITPNGKDLINGMNSRGRTSDAESTPRDHKPNEKLP QEDKGYPQPDASIVVFQPSKYAIYGITERGQRVCG -W...

Ngày tải lên: 14/09/2015, 09:24

12 187 0
Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 3

Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 3

... Figure 28 Inductive Non-inductive _ Figure 29 Figure 30 Inductive Non-inductive _ Figure 31 B A Figure 32 A B Figure 33 A B Figure 34 mgb1D WT _ rgs1Dmgb1D magB G1 83Smgb1D Figure 35 Figure 36 ... mgb1D WT _ rgs1Dmgb1D magB G1 83Smgb1D Figure 35 Figure 36 MG01 031 5 MG010105 MG09 134 Control: Gamma actin MG 039 82 MG011 73 MG01 630 Figure 37 A B

Ngày tải lên: 14/09/2015, 09:39

11 230 0
Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 4

Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 4

... Figure 39 WT rgs1D Figure 40 Figure 41 Figure 42 _ Figure 43 - Gd + Gd, 1h + Gd, 0h + Gd, 2h + Gd, 0.5h + Gd, 3h _ Figure 44 A WT rgs1D Solvent Solvent 10mM 8-Br-cAMP 10mM 8-Br-cAMP _ B WT rgs1D ... Solvent 10mM 8-Br-cAMP 10mM 8-Br-cAMP _ B WT rgs1D Figure 45 Appressorium formation on inductive membrane (%) Appressorium formation on Noninductive membrane (%) WT 89 1.5 mscL∆ 92 mscS1∆ 87...

Ngày tải lên: 14/09/2015, 09:53

9 180 0
Molecular analyses of gonad differentiation and function in zebrafish

Molecular analyses of gonad differentiation and function in zebrafish

... help in the study of gonad differentiation in zebrafish Studying gene function utilizing widely used molecular tools, such as gene knock-out, morpholinos, and cell culture, is also difficult in zebrafish ... during gonad differentiation: foxl2, cyp19a1a, cyp11a, hsd3b and cyp17a1 in ovarian differentiation and star, nr5a1a and cyp11b2 in testicular differ...

Ngày tải lên: 14/09/2015, 14:06

215 268 0
ELUCIDATING THE ROLE OF BNIP 2 IN ZEBRAFISH EARLY DEVELOPMENT

ELUCIDATING THE ROLE OF BNIP 2 IN ZEBRAFISH EARLY DEVELOPMENT

... 28 2. 1 Fish Spawning and Maintenance 28 2. 2 Molecular Biology Techniques 28 2. 2.1 RT-PCR Molecular Cloning 28 2. 2 .2 Polymerase Chain Reaction (PCR) 29 2. 2.3 Agarose Gel Electrophoresis 29 2. 2.4 ... prior finding of possibly interacting proteins of BNIP- 2 led to the formation of research questions: Does the physical interaction of BNIP- 2 with these prote...

Ngày tải lên: 05/10/2015, 19:05

122 337 0
Tài liệu SICK WATER? THE CENTRAL ROLE OF WASTEWATER MANAGEMENT IN SUSTAINABLE DEVELOPMENT pdf

Tài liệu SICK WATER? THE CENTRAL ROLE OF WASTEWATER MANAGEMENT IN SUSTAINABLE DEVELOPMENT pdf

... events from the origin of the wastewater to the consumption of the produce (e.g the farm-to-fork approach of the HAPPC method in food safety); • the design of a combination of health risk management ... Figure 19 in the timing and intensity of rainfall, or the period of time without rain, as well as affecting the quality of water in rivers and lak...

Ngày tải lên: 17/02/2014, 10:20

88 563 0
Từ khóa:
w