storing sequences in a relational database

... Seq("GTGAAAAAGATGCAATCTATCGTACTCGCACTTTCCCTGGTTCTGGTCGCTCCCATGGCA" "GCACAGGCTGCGGAAATTACGTTAGTCCCGTCAGTAAAATTACAGATAGGCGATCGTGAT" "AATCGTGGCTATTACTGGGATGGAGGTCACTGGCGCGACCACGGCTGGTGGAAACAACAT" "TATGAATGGCGAGGCAATCGCTGGCACCTACACGGACCGCCGCCACCGCCGCGCCACCAT" ... "TATGAATGGCGAGGCAATCGCTGGCACCTACACGGACCGCCGCCACCGCCGCGCCACCAT" "AAGAAAGCTCCTCATGATCATCACGGCGGTCATGGTCCAGGCAAACATCACCGCTAA", generic_dna) >>> gene.translate(table="Bacterial") Seq(’VKKMQSIVLALSLVLVAPMAAQAAEITLVPSVKLQIGDRDNRGYYWDGGHWRDH ... Seq(’CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGATGAGACCGTGG CGC’, IUPACAmbiguousDNA()) 740 Z78439.1 Seq(’CATTGTTGAGATCACATAATAATTGATCGAGTTAATCTGGAGGATCTGTTTACT GCC’, IUPACAmbiguousDNA()) 592...

Ngày tải lên: 22/10/2014, 21:00

... XMark Instead of storing the entire data as a single, large XML instance, it is more natural in a relational database to store the data in tables representing the different entities in the data ... Tatarinov, E Viglas, K Beyer, J Shanmugasundaram, E Shekita Storing and Querying Ordered XML Using a Relational Database System SIGMOD 2002 References [21] M Yoshikawa and T Amagasa XRel: a path-based ... save space in XML indexes, although it adds a JOIN in case of wildcard and //-axis queries Conclusions This paper introduces techniques for indexing XML instances stored in a relational database...

Ngày tải lên: 07/03/2014, 14:20

... X a liệu 3.4 Tính toán c a sổ (windows) 3.5 Input Patterns 48 3.5 Input Patterns  Một Input – Pattern Ri IP(Ri)  VD tìm IP(R1) ví dụ xét 49 50 3.5 Input Patterns  Nhận xét:  Với cách làm ta ... X a liệu 3.4 Tính toán c a sổ (windows) 3.5 Input Patterns 44 3.4 Tính toán c a sổ (windows)   M(Xi,X): tất tập Y ch a Xi mà có tồn thực thể đủ định ngh a Y Y tập nhỏ cho attr(CED(Y) ch a X ... 29 30 31 Tính insert liệu đủ 32 Khả thêm (insertable) kiện (fact)?  Xét đối tượng p thuộc P, tổng µ qua p: gọi thêm th a điều kiện sau: ∀ A ∈% , µ% (A ) N , Y ∉ where Y= p ∪ {A X ∈|i ( v r )i...

Ngày tải lên: 27/01/2015, 10:44

...    Insert Delete Update Query Kết luận 03/11/15 20 PP giải TH – Update Trong báo xem thao tác update = delete + insert  Hướng giải update lược đồ phổ quát tổng hợp thao tác delete + insert ... đến cao  Xếp hạng d a theo ràng buộc kh a ngoại quan hệ khác 03/11/15 12 PP giải TH – Insert Ví dụ vùng + xác định chuỗi kết hàm tối thiểu phủ đầy ... GV(MaGV, Hoten), HOC(MaGV, MaSV, MaMon) Hãy cho biết sinh viên học giáo viên tên ABC ? δHoten=ABC (GV  HOC)  Cần biết cấu trúc C () MAGV Cập nhật (Update + Delete + Insert): diễn Qi  cần biết cấu...

Ngày tải lên: 11/03/2015, 16:15

... manual tagging and (only) 24 for a second round of more problematic cases.6 While the full tagging of the lexical database may make the automatic tagging task appear superfluous, the low rate of agreement ... Computers and the Humanities, 34:217–222 Jean Carletta 1996 Assessing Agreement on Classification Tasks: The Kappa Statistic Computational Lingustics, 22(2):249–254, June Adwait Ratnaparkhi 2000 Trainable ... application to problems of ambiguity in natural language In Journal of Artificial Intelligence Research, number 11, pages 95–130 Hans Van Halteren, Jakub Zavrel, and Walter Daelemans 1998 Improving...

Ngày tải lên: 20/02/2014, 18:20

... and/or formalized representation of a domain’s ontology, including its data model The database schema is an example of a data model — a file format is not! A populated database — an instantiated ... Element Analysis with a Relational Database Backend 19 At this point, we have a grain selection and the face list on those grains, and a triangle selection and the face list containing those triangles ... Supporting Finite Element Analysis with a Relational Database Backend 23 We can certainly think of quite a few cosmetic changes to both database interfaces and visualization tools, which would have...

Ngày tải lên: 30/03/2014, 22:20

... changing data being read by a user and preventing users from reading data being changed by a user Locks are acquired and released by user actions; they are managed internally by database software ... the DataAdapter and CommandBuilder SqlDataAdapter da = new SqlDataAdapter(cmd); SqlCommandBuilder cb = new SqlCommandBuilder(da); // Fill table using the DataAdapter DataTable dt = new DataTable( ... when reading a table This allows you to read data and later update it with a guarantee that it has not changed since you last read it while other users are not blocked from reading the data Cannot...

Ngày tải lên: 17/10/2013, 20:15

... Stonebraker, M et al., "Application of Abstract Data Types and Abstract Indices to CAD Data," Proc Engineering Applications Stream of Database Week/83, San Jose, Ca., May 1983 [STON85] Stonebraker, ... 1980 ACM-SIGMOD Conference on Management of Data, Santa Monica, Ca., May 1980 [ASTR76] Astrahan, M et al., "System R: A Relational Approach to Data," ACM-TODS, June 1976 [BERN81] Bernstein, P and ... with a guarantee of atomicity and serializability In this case the access method designer has no problems concerning transactions, and this is a significant advantage for transparent transactions...

Ngày tải lên: 22/10/2013, 10:15

... containing the image from the database Create a SQL statement to retrieve the required image from the database and retrieve the image using a DataReader A DataTable or DataSet filled using a DataAdapter ... the image as a binary stream The BinaryWrite( ) method of the HttpResponse object writes a stream of binary characters to the HTTP output stream rather than a textual stream Response.BinaryWrite((byte[])dr["Photo"]); ... image from the database and serves it to the Image control on the web page that the client sees The following steps outline the required tasks: Create a web page that outputs a binary stream...

Ngày tải lên: 28/10/2013, 18:15

... that are bound to the same data source so that they display information from the object within the data source, such as a row in a DataTable The BindingContext class is used to instantiate a BindingManagerBase ... private BindingManagerBase bm; // private void DisplayDatabaseImageForm_Load(object sender, System.EventArgs e) { // Create the DataSet ds = new DataSet( ); // Create the DataAdapter and retrieve ... CurrencyManager notifies all data-bound controls if the current item changes so that they can refresh their data The PropertyManager class inherits from the BindingManagerBase class and maintains...

Ngày tải lên: 28/10/2013, 18:15

... reminding an experience, begging, making conditions, persuading and advising PAs are pragmatically represented by explaining and notifying in high frequency in both languages PAs in English has ... English and Vietnamese (2) Pragmatically, the study focuses on classifying and analyzing the features of PAs in both languages such as: surveying, notifying, confirming, introducing, explaining, drawing ... observation of turn-taking system is that speaker-change always occurs, and a person does not continue -9talking indefinitely; instead one person stops talking and another begins b Adjacency Pair and...

Ngày tải lên: 26/11/2013, 13:21

... LANGUAGE LEARNING AND TEACHING As a common phenomenon in communication, PAs cannot be ignored in the learning and teaching of English Through the study of pre -sequences in English and Vietnamese, ... that certain utterances are usually (even, in some instances, always) felt to be “precursors” to b Face Classification another utterances According to him, “utterances which serve c Face Threatening ... can be a “go-ahead” (acceptance and paying attention) A “silence”/“ignorance” (rejecting) or a “stop”(denying) 2.3 SUMMARY 200 samples of pre-announcements in English and 200 in Vietnamese must...

Ngày tải lên: 26/11/2013, 13:22

... ideas or feelings such as ordering, promising, cultures In many cases, non- native speakers and native speakers fail complaining etc and invitation is indispensable to understand each other that ... effective Reasoning, Confirming, Persuading, Advertising, Introducing, Although Pre-invitation sequences in both languages share a Showing the attitude/ the honor to the listener, Explaining, Drawing ... showing a good will, advising and reminding is a good way notifying, reasoning and advertising, reminding a good experience in to show the speaker’s affection to the hearer So that, Hs feel the Interrogatives...

Ngày tải lên: 26/11/2013, 13:22

... M+0#!7&%'7)0-!)%!&079(.0!)+0!+%'0!7(308!.9* .A! >%5! f5! G#!)+0!6%%9,!'0#/8!.9* .A! M01!J0))*#3,8!,090.)!)+0!L()(1(,0!)(18!)+0#! ,090.)!0(.+!=%##0.)*%#!(#-!.9* .A! S0&*$;8!(#-!)+0#!.9* .A! GZ5! H%&!*#,)&/.)*%#,!%#!*'7%&)*#3!>0)4% &A" #.5'-18!&0$0&!)%!0?0&.*,0!^!%$!O(1! ... I&0

Ngày tải lên: 21/12/2013, 19:15

... MANAGING TIME IN RELATIONAL DATABASES Companion Web site Ancillary materials are available online at: www.elsevierdirect.com/companions/9780123750419 MANAGING TIME IN RELATIONAL DATABASES ... contained in the material herein Library of Congress Cataloging -in- Publication Data Application submitted British Library Cataloguing -in- Publication Data A catalogue record for this book is available ... specializing in enterprise data architecture, including the logical and physical modeling of very large database (VLDB) systems in the financial, insurance and health care industries He has been...

Ngày tải lên: 24/12/2013, 02:16

... happened It seems to us that, in fact, warehouses are the form that backup files took when brought on-line and assembled into a single database instance, and data marts are the form that transaction ... single block labeled “data” In a non-temporal table, each row stands for a particular instance of what the table is about So in a Customer table, for example, each row stands for a particular ... Excluding Time from Databases: A Ubiquitous Paradigm In one sense, temporal data has been accorded only secondclass status since the advent of computers and their use in managing business data Neither...

Ngày tải lên: 24/12/2013, 02:16

... Transactions to maintain temporal data must be as easy to write as are transactions to maintain current data Queries to retrieve temporal data, or a combination of temporal and current data, ... Queryable data is the opposite Temporal Data Management Reconstructable Temporal Data Queryable Temporal Data Event Temporal Data State Temporal Data Uni-Temporal Data Bi-Temporal Data The Alternative ... Managing Temporal Data In terms of granularity, temporal data can be managed at the level of databases, or tables within databases, or rows within tables, or even columns within rows And at each...

Ngày tải lên: 24/12/2013, 02:16

... temporal data And for any readers who might think that temporal data management is just a small step beyond the versioning they are already familiar with, many of the constraint-checking SQL statements ... datasets We define a pipeline dataset as any collection of business data that is not a production table, but that contains data whose destination or origin is such a table.1 Pipeline datasets The ... be applied to a database by also internalizing them within their target tables In this book, we will show how the use of these internalized managed objects reduces the costs of maintaining databases...

Ngày tải lên: 24/12/2013, 02:16

... pipeline dataset, and the internalization of pipeline datasets can eliminate a large part of the IT maintenance budget by eliminating the need to manage pipeline datasets as distinct physical objects ... transaction begin date always indicates when a row is physically inserted into a table, an assertion begin date indicates when we are first willing to assert, or claim, that a row is a true statement ... at the beginning of that month, not at its end This is because we are using a clock that ticks once a month and so that transaction, once applied, will remain in the database for at least that...

Ngày tải lên: 24/12/2013, 02:16