Ngày tải lên: 28/06/2014, 17:20
... transporter. Abbreviations AR, L- arabinose reductase; LAD, L- arabitol-4-dehydrogenase; LXR, L- xylulose reductase; PYCC, Portuguese Yeast Culture Collection; XDH, xylitol dehydrogenase; XK, D-xylulose kinase; XR, D-xylose ... diameter) and the l- ter washed twice with 10 mL ice-cold demineralized water. The filter was then transferred to a scintillation vial con- taining 6 mL liquid-scintillation cocktail Wallac OptiPhase ‘HiSafe’ ... degra- dation involves two additional redox reactions as compared with d-xylose metabolism (Fig. 1). l- arabitol is oxidized to l- xylulose by an l- arabitol 4-dehydroge- nase, and l- xylulose is converted...
Ngày tải lên: 19/02/2014, 00:20
Tài liệu How To Close every sale By Joe Girard and roBerT l. sHook ppt
... the nal major close. For example, • “Would you like to handle the payments monthly, quarterly or annually?” • “Is it okay to use your home address for the billing?” • “Would you spell your ... exactly that. Enthusiastically, Closing a sale is the stage in the selling process where salespeople meet the greatest diculty. Joe Girard walks the reader through fundamental selling principles ... about. Be a good listener Outstanding salespeople are excellent listeners. A professional salesperson understands how the prospect thinks and feels by listening. Page 3 SUMMARIES SUCCESS Bibliographic...
Ngày tải lên: 19/02/2014, 10:20
Educating the Net Generation by Diana G. Oblinger and James L. Oblinger, Editors ppt
... ideally should be relatively up to date and able to provide students with not only fundamental skills but also the chance to learn intermediate and advanced skills as the “cool new thing” rolls ... Neomillennial Learning Styles: Implications for Investments in Technology and Faculty by Chris Dede, Harvard University • How Emerging Media Foster Neomillennial Learning Styles • Conclusion ... records, and letters from soldiers and their families constitute the original source material that allows students to engage in “first-person learning.” The site also serves formal and informal learners....
Ngày tải lên: 06/03/2014, 21:20
Báo cáo khóa học: Membrane transport of fatty acylcarnitine and free L-carnitine by rat liver microsomes pot
... reticulum membrane. Mol. Biol. Cell. 11, 3675–3687. 17. Polokoff, M.A. & Bell, R.M. (1978) Limited palmitoyl- CoA penetration into microsomal vesicles as evidenced by a highly latent ethanol acyltransferase ... a cytosolically oriented DGAT, has been described [5–7]. This latent DGAT may be involved in the reassembly of triacylglycerols which lipidate very low density lipoprotein (VLDL) particles as part ... the endoplasmic reticulum. Missing links in the VLDL story? Adv. Exp Medical Biol. 466, 59–67. 13. Joyce, C., Skinner, K., Anderson, R.A. & Rudel, L. L. (1999) Acyl- coenzyme A: cholesteryl acyltransferase...
Ngày tải lên: 16/03/2014, 16:20
Searchlights on Health by B. G. Jefferis and J. L. Nichols pptx
... boon and a blessing to thousands who consult its pages. The world is full of ignorance, and the ignorant will always criticise, because they live to suffer ills, for they know no better. New light ... Pain, page 304 Solemn Lessons for Parents, page 312 Ten Health Rules for Babies
Ngày tải lên: 22/03/2014, 23:20
Searchlights on Health: Light on Dark Corners, by B.G. Jefferis and J. L. Nichols doc
... who walk much with the lame, who have learned to walk with a hitch or limp like their lame friends. Vice stalks in the streets unabashed, and children copy it. 5. Live with the Culpable.—Live ... with the culpable, and you will be very likely to die with the criminal. Bad company is like a nail driven into a post, which after the first or second blow, may be drawn out with little difficulty; ... Fatal.—Begin well, and the habit of doing well will become quite as easy as the habit of doing badly. "Well begun is half ended," says the proverb; " ;and a good beginning is half...
Ngày tải lên: 22/03/2014, 23:20
Neurodegeneration Edited by L. Miguel Martins and Samantha H.Y. Loh pot
... 93 Carla Caruso, Lila Carniglia, Daniela Durand, Teresa N. Scimonelli and Mercedes Lasaga Chapter 7 Mechanisms and Patterns of Axonal Loss in Multiple Sclerosis 121 Zachary M. Harris and Jacob ... resulting from the metal- peptide interactions. In performing these simulations carrying them out in biologically relevant time scales will be a challenge that will need to be met. It will also ... Rh and Ir solvato-complexes contain 2-phenyl pyridine, benzoquinoline, or phenyl quinoline ligands. Presumably, the labile solvent (H 2 O) molecules are displaced by the histidine imidazoles...
Ngày tải lên: 23/03/2014, 15:20
SMALL IS BEST LESSONS FROM ADVANCED ECONOMIES RYAN BOURNE AND THOMAS OECHSLE potx
... Finland, France, Germany, Greece, Hong Kong, Iceland, Ireland, Israel, Italy, Japan, Korea, Luxembourg, Malta, Netherlands, New Zealand, Norway, Portugal, Singapore, Slovak Republic, Slovenia, ... analysis are: Australia, Austria, Belgium, Canada, Czech Republic, Denmark, Estonia, Finland, France, Germany, Greece, Iceland, Ireland, Israel, Italy, Japan, Luxembourg, Netherlands, New Zealand, ... Kong Ireland Japan Korea Singapore Spain Switzerland Taiwan US Austria Belgium Canada Cyprus Czech Republic Denmark Finland France Germany Greece Iceland Israel Italy Luxembourg...
Ngày tải lên: 23/03/2014, 20:20
Asthma WellnessKeeping Children with Asthma in School and Learning Liability & Litigation: A Legal Primer Asthma & Indoor Air Quality (IAQ)Asthma Management, Policies and Procedures.St r a i g h tBy Paul D. Houstont a l kIn School and Healthy: docx
... district- wide guidelines and protocols applicable to chronic illnesses generally and specific protocols for asthma and other common chronic illnesses of students. Dr. Howard Taras, medical consult- ant ... illness compensation bill. ■ students the right to carry and use asthma inhalers at school Legal checklist • Know the law and be proac- tive in following it. • Ensure you have policies in place ... Indoor Air Quality (IAQ) C hildren are especially vul- nerable to the adverse health effects of indoor pollutants and allergens—more so than adults. Students with asthma are particularly at risk (GAO,...
Ngày tải lên: 23/03/2014, 23:20
Báo cáo khoa học: Characterization of L-aspartate oxidase and quinolinate synthase from Bacillus subtilis potx
... NADA_SALTY LLEAPTAGEG ATCRSCAHCPWMAMNGLKAIAEGLEQGGAA HEIQVDAALREGALLPLN 336 NADA_BACSU QIESLN PDMCPCLTMNRIDLPHLLWSLEQIEKGEP SGVIKVPKAIQEDALLALN 362 NADA_HELPY NTFILS STLALCPTMNETTLKDLFEVLKAYKNHRA ... MSILDVIKQSNDMMPESYKELSRKDMETRVAAIKKKFGSRLFIPGHHYQKDEVIQFADQTG DSLQLAQVAEKNKE ADYIVFCGVHFMAETADMLTSEQ 98 NADA_HELPY MPTDNDLKAAILELLRDLDVLLVAHFYQKDEIVELAHYTG DSLELAKIASQS-D KNLIVFCGVHFMGESVKALAFDK 76 NADA_METTH MLNQLQRDILRLKKEKNAIILAHNYQSREIQEIADFKG ... TTRA-RQVLVATEVGMLHQLRRAAPEVD 290 NADA_ATHAL HSLDSIKSLLPRLHYFQEGTCIVHHLFGHEVVERIKYMYCDAFLTAHLEVPG EMFSLAMEAKKREMGVVGSTQNILDFIKQKVQEAVDRNVDDHLQFVLGTESGMVTSIVAVIRSLL 355 NADA_OSATI HNKKSINALLPRLHYYQDGNCIVHDMFGHEVVDKIKEQYCDAFLTAHFEVPG...
Ngày tải lên: 30/03/2014, 02:20
Báo cáo khoa học: DNA-binding and transcription characteristics of three cloned sigma factors from mustard (Sinapis alba L.) suggest overlapping and distinct roles in plastid gene expression doc
... three cloned sigma factors from mustard ( Sinapis alba L. ) suggest overlapping and distinct roles in plastid gene expression Anke Homann and Gerhard Link Plant Cell Physiology and Molecular Biology, ... cDNA library [14]. Clones pAD/3C1Sig2 and pAD/4B2Sig3 contained the full-length SaSig2 and SaSig3 cDNAs, respectively. Correspondence to G. Link, Plant Cell Physiology and Molecular Biology, ... (lanes 2 and 3), and full reactions (labelled DNA plus core plus sigma) incubated with unlabelled excess competitor DNAs (lanes 12–16). The latter were either the promoter-less fragment Bam0.5 (lanes...
Ngày tải lên: 31/03/2014, 07:20
sachdev p.l. self-similarity and beyond.. exact solutions of nonlinear problems
Ngày tải lên: 24/04/2014, 17:09
Bạn có muốn tìm thêm với từ khóa: