... COMPOSTS A Pathway Risk Assessment Used for the U. S EPA Section 503 Rule This section summarizes risk assessment for trace elements and current regulations needed to keep composts and biosolids utilization ... Contaminants in Beneficially Used Biosolids and Composts A Pathway Risk Assessment Used for the U. S EPA Section 503 Rule B U. S Limits on Contaminants in Biosolids and Composts C Hidden Safety Factors in ... H Food Consumption Rates vs Cadmium Risk Potential I Are Soil Microbes Protected by the U. S EPA Section 503 Rule? J Using the U. S EPA Section 503 Biosolids Limits for Other Composts and Organic...
Ngày tải lên: 11/08/2014, 06:22
... lower urinary tract symptoms in five countries: results of the EPIC study Eur Urol 2006; 50:1306 Herschorn S, Gajewski J, Schulz J and Corcos J A population-based study of urinary symptoms and ... years (p
Ngày tải lên: 25/10/2012, 11:35
MEASURING SAFETY CULTURE IN THE AUSTRALIAN REGIONAL AIRLINE INDUSTRY: THE DEVELOPMENT OF THE AIRLINE SAFETY CULTURE INDEX
... phạm vi nghiên c u, nhu c u chia làm loại khác nhau: nhu c u vật chất nhu c u tinh thần Theo mức độ thỏa mãn, nhu c u chia làm loại: nhu c u bậc thấp, nhu c u vận động, nhu c u s ng tạo 5.1.2 Hệ ... thành loại thep mức độ từ thấp đến cao sau: Nhu c u sinh lý Nhu c u an toàn Nhu c u xã hội Nhu c u tôn trọng Nhu c u tự hoàn thiện Học thuyết tăng cường tích cực B.F Skinner Học thuyết hướng ... Industruyal System Company”, tên viết tắt “VA INSYS” với nhiệm vụ chủ y u thương mại, cung cấp, lắp đặt phần điện Công nghiệp cho khu Công nghiệp, nhà máy, khu trung cư cao tầng khu chế xuất...
Ngày tải lên: 19/04/2013, 23:00
Tài liệu TRADITIONAL AND NOVEL RISK FACTORS IN ATHEROTHROMBOSIS pptx
... and Novel Risk Factors in Atherothrombosis phase of thrombus formation Adhesion molecules and its receptors on platelets are essential for thrombus formation, because these molecules support platelet ... high shear stress is frequently correlated with the rupture sites This finding is inconsistent with role of low shear stress on atherogenesis It is possible that the process of initiating plaque ... recruited 306 patients who presented to the ED with suspected cardiac chest pain BNP was measured using two separate assays at the time of admission The AUC of each assay for a diagnosis of ACS...
Ngày tải lên: 12/02/2014, 16:20
Tài liệu Báo cáo khoa học: Dmrt1 genes at the crossroads: a widespread and central class of sexual development factors in fish pdf
... Paralichthys olivaceus Scaphirhynchus platorynchus Sparus auratus G G Testis Testis and ovary – Higher in testes pA Testis Silurus meridionalis G Ovary and testis Takifugu rubripes Xiphophorus maculatus ... Odontesthes bonariensis [26], rainbow trout Oncorhynchus mykiss [27], shovelnose sturgeon Scaphirhynchus platorynchus [28] and southern catfish Silurus meridionals [29] a strong male-biased expression ... Monopterus albus G pG pG Odontesthes bonariensis TSD Testis Testis Testis, ovotestis and ovary (sex-specific splice variants Primordial gonads During spermatogenesis – – High in testes Oncorhynchus...
Ngày tải lên: 14/02/2014, 19:20
Tài liệu HEMATOPOIETIC GROWTH FACTORS IN ONCOLOGY BASIC SCIENCE AND CLINICAL THERAPEUTICS pptx
... assessed Not assessed Not assessed (effects accentuated by splenectomy) Not assessed Not assessed ↑ Endosteal osteoclasts ↑ Medullary cavity ↑ Periosteal bone Not assessed ↑ Neutrophils in lung and ... background counterparts (171) These observations suggest that this murine myeloproliferative disorder requires signals exclusively provided by G-CSF for its full manifestation CONCLUSIONS Although much ... progress in various areas of basic science that may lead to further advances in hemopoietic cell regulation There are also sections on the utility of growth factors in infectious disease settings such...
Ngày tải lên: 16/02/2014, 07:20
Tài liệu Báo cáo khoa học: Roles of AP-2 transcription factors in the regulation of cartilage and skeletal development doc
... MHSPPRDQAAIMLWKLVENVKYEDIYEDRHDGVPSHSSRLSQLGSVSQGPYSSAPPLSHT -MLWKITDNVKYEEDCEDRHDGSSNGNPRVPHLSSAGQHLYSPAPPLSHT -MLVHTYSAME -RPDGLG-AAAGGARLSSLPQAAYGPAPPLCHT -MSTTFPGLVHDAEIRHDGSNSYRLMQLGCLESVANSTVAYSSSSPLTYS ... link the expression of AP-2a in these tissues to upstream signaling pathways They assessed the organization of a cis-regulatory region within the fifth intron specific for directing AP-2a expression ... in mice results in a lack of osteoblasts throughout the skeleton [61,62] It has also been shown that deletions resulting in the heterozygous loss of runx2 cause cleidocranial dysplasia [63] Role...
Ngày tải lên: 16/02/2014, 09:20
Tài liệu Risk Factors in Implant Denistry: Simplified Clinical Analysis for Predictable Treatment ppt
... smoker has a 10% higher risk of osseointegration failure Likewise, a bruxer has an i ncreased risk of fracturing prosthetic components These patients should be considered risk patients Some risk ... peri-implant soft tissue) and/or peri-implantitis (infectious bone loss around the implant) If the edentulism is associated with natural teeth fractured because of bruxism or severe occlusal disorder, the ... Note The presence of several factors indicates a risky situation for the implants and prosthesis Geometric Risk Factors Number of implants less than number of root supports (Fig 3-1) To define the...
Ngày tải lên: 16/02/2014, 15:20
Tài liệu Báo cáo khoa học: Roles of heat shock factors in gametogenesis and development pptx
... but no such activity was found in the other study ([68], our unpublished data) Hsf2 knockout phenotypes HSF2 deficiency results in reduced testis size, as well as reduced sperm count and vacuolization ... contrast, HSF4 preferentially binds to the discontinuous HSE of c(C)-crystallin, whereas HSF1 prefers the continuous HSEs in the promoters of c(A)- and c(B)-crystallin These results suggest that the ... phenotypes; and genes that determine or influence lens structure, such as crystallins or lens-specific beaded filament structural proteins (Bfsp) With an unusual occurrence in the history of HSFs, the...
Ngày tải lên: 18/02/2014, 04:20
Tài liệu Báo cáo khoa học: Characterization of the promoter for the mouse a3 integrin gene Involvement of the Ets-family of transcription factors in the promoter activity doc
... shift assay (EMSA) using the Ets consensus site at )133 As the involvement of the Ets consensus binding site at )133 in the promoter activity of the mouse a3 integrin gene was suggested by the luciferase ... this region is responsible for the regulation of a3 integrin expression, we subsequently prepared several constructs with or without this segment by PCR and successive subcloning into pGL3-basic ... constructed in pGL3-basic Transfection and luciferase assay Luciferase assay was conducted using a Luciferase Assay System (Promega) along with reporter plasmids constructed in pGL3-basic plasmid...
Ngày tải lên: 21/02/2014, 03:20
Báo cáo " A web-based decision support system for the evaluation and strategic planning using ISO 9000 factors in higher education " pot
... dean, staff and instructor groups Secondly, the questionnaires are pre-tested before they become standard questionnaires used for survey During pre-testing the questionnaires, it is necessary ... password for the permission of the system All logical modeling steps of the system module can be shown as follows: Menu control system: The user can view DSS list results or input a new DDS application ... problem, the first study step of this study focuses on analyzing ISO factors for a DSS model in educational management The second step of this study is to find out good techniques in DSS The third step...
Ngày tải lên: 05/03/2014, 14:20
Nutritional Status and Associated Factors in Institutionalized Elderly docx
... homogeneous subgroups of individuals for the systematic comparison of their characteristics The division process is repeated until none of the selected variables show significant influence on the ... decision tree The tree starts with a root node, with all the observations in the sample, and the subsequent branches represent subdivisions and subsets of data This subdivision allows the identification ... [12] For the diagnosis of risk and malnutrition, particularly in the elderly, the Mini Nutritional Assessment was also utilized [13] For the assessment of food intake, we used the three day food...
Ngày tải lên: 05/03/2014, 21:20
Báo cáo khoa học: Binding affinities and interactions among different heat shock element types and heat shock factors in rice (Oryza sativa L.) ppt
... OsHsfs were expressed in yeast cells containing a Gal4-regulated His3 reporter construct [31] Among five class A OsHsfs (OsHsfA2a, OsHsfA2c, OsHsfA2d, OsHsfA7 and OsHsfA9) Gal4 fusions of OsHsfA2c, ... Heat shock element types and heat shock factors in rice Introduction The synthesis of heat shock proteins (Hsps) represents one of the most thoroughly studied induced gene expression systems Hsp ... information The following supplementary material is available: Table S1 In silico analysis for the putative phosphorylation sites in rice Hsfs Table S2 List of primers used in this study This supplementary...
Ngày tải lên: 05/03/2014, 23:20
COMMON RISK FACTORS IN THE RETURNS ON STOCKS AND BONDS potx
Ngày tải lên: 06/03/2014, 08:20
Factors infl uencing the risk of breast cancer – established and emerging ppt
... doctors are still unsure of the causes2,3 One of the suggested additional risk factors for breast cancer is the environment, i.e the world around us This may come as a surprise to some people, as ... research has suggested exposure to tobacco smoke may increase risk Exposure to second-hand smoke (passive smoking), has been found to slightly increase breast cancer risk3 7 and research suggests ... Trust, the Marisla Foundation and the European Commission, DG Environment The views expressed in this publication not necessarily reflect the official views of the funders and the EU institutions...
Ngày tải lên: 15/03/2014, 01:20
Cornell University Program on Breast Cancer and Environmental Risk Factors in New York State (BCERF) pptx
... decreased breast cancer risk It is not uncommon for epidemiological studies to come to different assessments of health risk, especially when, as in these studies, the associated risk is not large ... levels breast cancer risk association More work is needed to resolve these issues Why are there differences in the results of the human epidemiological studies examining breast cancer risk and passive ... breast cancer risk has been examined in five studies These studies typically looked at exposure up to age 19 Four of these studies used women with no exposure to tobacco smoke as controls and reported...
Ngày tải lên: 15/03/2014, 01:20
HIDDEN COST REDUCTIONS IN BANK MERGERS: ACCOUNTING FOR MORE PRODUCTIVE BANKS docx
... cases where the purchase accounting method was used for the merger transaction, the merged bank reported the expenses equal to the acquirer s full quarter of expenses plus the expenses incurred ... repurchase; otherwise, the purchase accounting method must be used Figure shows that in our merger sample, about one-third of the mergers used purchase accounting method to account for the merger ... whereas unadjusted premises expense showed a significant rise after the merger in this time period The adjustment for premises expense is significantly positive in all three subperiods The adjustment...
Ngày tải lên: 15/03/2014, 10:20
Báo cáo khoa học: Factors influencing RNA degradation by Thermus thermophilus polynucleotide phosphorylase ppt
... UGCCUAGGCAUCUCCCGCGCGCCGGUUUCGGAC CUCCAGUGCGUGUUACCGCACUGUUAGCCCGGG UACCGAGCUCGAAUUCGUAAUCAUGGUCAUAGC UGUUUCCUGUGUGAAAUUGUUAUCCGCUCACAA UUCCACACAACAUACGAGCCGGAAGCAUAAAGU GUAAAGCCUGGGGUGCCUAAUGAGUGAGCUAA CUCACAUUAAUUGCGUUGCGCUCACUGCCCGCUU ... GGGGUUCCAACCGGAAGUUGAGGGAUGCCUAGG CAUCCCCCGUGCGUCCCUUAAAGCUUCAUUCUUC CUUUCUUUAAAAGAGAGAGAGAGAAAGCGAGGG AUUUGAGAGAUGCCUAGGCAUCUCCCGCGCGCC GGUUUCGGACCUCCAGUGCGUGUUACCGCACUG UUAGCCC The 5¢ fragment ... GGCGCUGCAGCUCGA GUCUAGAGGAUCCUACGAGGGAUUUGAGAGAUG CCUAGGCAUCUCCCGCGCGCCGGUUUCGGACCU CCAGUGCGUGUUACCGCACUGUUAGCCCGGGUA CCGAGCUCGAAUU Transcript PvuII (the 3¢ fragment of RQ135 RNA extended at the...
Ngày tải lên: 16/03/2014, 06:20
Báo cáo khoa học: Alternative initiation of transcription of the humanpresenilin 1gene in SH-SY5Y and SK-N-SH cells The role of Ets factors in the regulation ofpresenilin 1 pptx
... tissues, its expression is remarkably high in the brain [35] and this also suggests its importance for the regulation of PS1 in vivo in this tissue Acknowledgements This research was supported ... deletion of sequences downstream from +107 or mutations at the +129 site in particular does not just result in loss of function, but rather produces a cis-acting negative effect, such as an abortive ... recognize Ets sites +129 and/or +165 Discussion The PS1 promoter appears to be used alternatively in SKN-SH cells and its SH-SY5Y subclone Two Ets elements at )10 and +90 appear to play an essential...
Ngày tải lên: 16/03/2014, 18:20