new features of openvpn 2 1 and 2 2

Tài liệu Báo cáo Y học: Binding of gelsolin domain 2 to actin An actin interface distinct from that of gelsolin domain 1 and from ADF/cofilin pptx

Tài liệu Báo cáo Y học: Binding of gelsolin domain 2 to actin An actin interface distinct from that of gelsolin domain 1 and from ADF/cofilin pptx

... and mixed with 1 12 12 5 and 11 9– 1 32 actin peptides As shown in Fig 8B, the 11 9 1 32 peptide does not perturb FITC In contrast the 1 12 12 5 peptide induces a fluorescence decrease of the label, but ... sequences Peptide 15 9 19 3 Kd ELISA Peptide 15 9 19 3 Kd fluorescence Cofilin Kd Reference for cofilin Actin G Actin F 1 10 18 28 84 10 3 1 12 12 5 11 9 1 32 347–365 338–348 360–3 72 355–375 1. 3 mM ND No binding ... Two peptides belonging both to the 11 4 22 5 sequence and exposed regions of subdomain were tested (1 12 – 12 5 and 11 9 – 1 32 peptides) Interaction of the 15 9 19 3 fragment with the coated peptides...

Ngày tải lên: 22/02/2014, 07:20

11 465 0
Báo cáo toán học: "Graphs Associated with Codes of Covering Radius 1 and Minimum Distance 2" ppsx

Báo cáo toán học: "Graphs Associated with Codes of Covering Radius 1 and Minimum Distance 2" ppsx

... electronic journal of combinatorics 15 (20 08), #R68 3 X X X 0 Figure 5: The partial Latin square equivalent {000, 011 , 022 , 10 1, 11 0, 13 3, 20 2, 21 3, 22 1, 23 0, 303, 320 , 3 32} to the code Figure ... permutation R( 12 ) C( 12 ) S( 12 ) squares with row of 032X and 023 X are equivalent to squares with row of 013 X and 031X Thus only squares with row of 012 X, 0 21 X, 013 X, or 031X are considered (figure 16 ) • ... 1, 2) = 16 We completely catalogue (3, V, 2) 4 codes where V = 8, 9, 10 , 11 , 13 , 14 , 15 , 16 and provide some examples for V = 12 Theorem 12 [6, Thm 3 .14 ] There is a unique (3, 8, 2) 4 code Proof...

Ngày tải lên: 07/08/2014, 15:23

17 253 0
báo cáo khoa học: " FCR (Fludarabine, Cyclophosphamide, Rituximab) regimen followed by 90yttrium ibritumomab tiuxetan consolidation for the treatment of relapsed grades 1 and 2 follicular lymphoma: a report of 9 cases" pot

báo cáo khoa học: " FCR (Fludarabine, Cyclophosphamide, Rituximab) regimen followed by 90yttrium ibritumomab tiuxetan consolidation for the treatment of relapsed grades 1 and 2 follicular lymphoma: a report of 9 cases" pot

... et al Journal of Experimental & Clinical Cancer Research 20 11 , 30 :16 http://www.jeccr.com/content/30 /1/ 16 Received: 30 September 20 10 Accepted: February 20 11 Published: February 20 11 References ... (Table 2) Restage before RIT: CT, PET, BMB Zevalin® FCR -28 CYCLES 11 .1- 14.8 MBq/Kg CR/CRu or PR F: 25 mg/m2 i.v days 1- 3 C: 1gr/m2 i.v day R: 375mg/m2 i.v day Figure Treatment schema Restage 12 weeks ... cycles of FCR: fludarabine at a dose of 25 mg/m2 i.v on days to 3; cyclophosphamide at a dose of gr/m2 i.v on day and rituximab Page of at a dose of 375 mg/m2 was given on day of each cycle every 28 ...

Ngày tải lên: 10/08/2014, 10:21

5 293 0
The roles of histone deacetylases 1 and 2 in hepatocellular carcinoma

The roles of histone deacetylases 1 and 2 in hepatocellular carcinoma

... 17 1. 9 Cooperative and distinct functions of HDAC1 and 18 1. 9 .1 Redundancy of HDAC1 and HDAC2 functions 18 1. 9 .2 Distinct functions of HDAC1 and HDAC2 19 1. 10 Inhibition of ... 20 1. 11 Biological effects and mechanisms of action of HDAC inhibitors 20 1. 11. 1 Apoptosis 20 1. 11 .2 Growth arrest 22 1. 11. 3 Mitotic disruption and autophagy ... 23 1. 11. 4 Anti-angiogenesis, anti-metastasis and invasion 24 1. 11. 5 Anti-tumor immunity 25 1. 12 HDAC inhibitors in cancer therapy 26 1. 12 . 1 Clinical trials 26 ...

Ngày tải lên: 10/09/2015, 08:27

168 373 0
A study on syntactic, semantic and pragmatic features of exaggeration in english and vietnamese

A study on syntactic, semantic and pragmatic features of exaggeration in english and vietnamese

... 0% 1. 6% Complaint 44 8.8% 37 7.4% Appearance 26 5 .2% 28 5.6% Sympathy 0% 28 5.6% Beauty 18 3.6% 0% Thanking 28 5.6% 0% Ugliness 11 2. 2% 11 2. 2% Irony 96 19 .2% 12 6 25 .2% Sexuality 10 2% 12 2.4% ... Interest 12 1 24 .2% 1 02 20.4% Tiredness 0% 1. 6% Total 500 10 0% 500 10 0% Movement 12 2.4% 20 4% Total 500 10 0% 500 10 0% 4.3 Pragmatic Features of Exaggeration in English and Vietnamese 4.3 .1 Exaggeration ... Exaggeration of Thanking Sadness 78 15 .6% 72 14 .4% 4.3.7 Exaggeration of Irony Happiness 1 02 20.4% 10 5 21 % 4.3.8 Exaggeration of Interest Anger 46 11 .2% 59 11 .8% Table 4.4 Frequency of Pragmatic Features...

Ngày tải lên: 26/11/2013, 13:16

13 1,6K 4
A study on linguistic features of english competition law and vietnamese competition law

A study on linguistic features of english competition law and vietnamese competition law

... Nominal 419 42. 6% 18 7 44.7% Verbal 24 1 24 .5% 13 4 32. 1% Adjectival 15 6 15 .9% 54 12 . 9% Adverbial 87 8.8% 32 7.7% 95% Prepositional 65 6.6% 0.0% 33% Pronominal 16 1. 6% 11 2. 6% 984 10 0% 418 10 0% Table ... Occurrence Rate With 32 21. 3% 10 0% Table 4.7 Average number of words per sentence in ECL and VCL 78.7% 0% 15 0 10 0% Words ECL 379 16 .3 52 44 25 4 17 . 014 67 6 01 23 .366 11 3 Average 10 0% parentheses Total ... language used by a profession” especially true in the area of law.” The main reason for this lack of 2. 2 .2 Lexical Features 2. 2 .2. 1 Technical Terms According to Gustafsson [16 , p .24 ] “law language...

Ngày tải lên: 26/11/2013, 13:18

13 811 0
A study of semantic and pragmatic features of the adjective warm and its vietnamese equivalents

A study of semantic and pragmatic features of the adjective warm and its vietnamese equivalents

... ORGANIZATION OF THE STUDY 2. 2 THEORETICAL BACKGROUND The thesis includes five main chapters, references and an appendix as follows: 2. 2 .1 Semantic Features 2. 2 .1. 1 Semantics Chapter 1: “Introduction” ... hyponym of animal 2. 2 .1. 7 Semantic field The semantic structure of vocabulary of a language can be studied in a precise and systematic way by means of componential analysis of which the theory of ... shows their and Heidi Weber [28 , p 25 4] say that semantic features are “the relationship to one another.” smallest units of meaning in a word The meaning of a word may be 2. 2 .2 The Notions and the...

Ngày tải lên: 26/11/2013, 13:21

13 866 0
A study of linguistic features of proverbs expressing richness and poverty in english versus vietnamese

A study of linguistic features of proverbs expressing richness and poverty in english versus vietnamese

... 13 .5% Property 57 28 .5% 30 15 % Class 63 31. 5% 62 31% Work 20 10 % 30 15 % Behavior 0 21 10 .5% and poverty also are presented variety in both English and Vietnamese 20 0 10 0% 20 0 10 0% While Vietnamese ... in Relation to Folk Verses 2. 2.4 Proverbs in Relation to Idioms 2. 2.5 Relation of Culture and Proverbs 2. 2.5 .1 Language and Culture 2. 2.5 .2 Proverbs and Culture 13 14 quantitative approach to ... Property [15 ] Adjective Clauses [16 ] Nominal Clauses [17 ] Comparative Clauses Ø [18 ] SVC [19 ] SVA [20 ] SVOC Ø [ 21 ] Adjective Clauses [22 ] Nominal Clauses [23 ] SVO [24 ] SVC [25 ] SVOC Ø [26 ] Asyndetic...

Ngày tải lên: 26/11/2013, 13:23

13 1,3K 1
A study of linguisitc features of personification in english and vietnamese love songs

A study of linguisitc features of personification in english and vietnamese love songs

... Percentage 24 21 22 49 16 % 14 % 14 .67% 32. 67% 5.33% 2% 0% 31 30 23 11 14 20 .67% 0% 20 % 15 .33% 7.33% 2. 67% 1. 33% 9.33% 0.67% 2% 5.33% 14 9.33% 0% 1. 33% 0% 2% 0.67% 0 2. 67% 1. 33% 6% 4.67% Songs 4 .2. 3 .1 Similarities ... syntax [16 , p 15 01] [16 3] The thesis is based on the viewpoint of Randolph Quirk and 2. 2 .2. 2 Personifications and Metonymies Sydney Greenbaum on grammar for features of English grammar in (2. 25) ... Happines 25 s Conflict 16 .67% 42 3.33% 2. 67% 15 0 10 0% 15 0 10 0% Categories in English and Vietnamese 28 % 4 .2. 2 Distribution of Personification in Terms of Syntactic [2] Adverbial Clauses – Clauses of...

Ngày tải lên: 26/11/2013, 13:25

13 1,2K 3
A study of linguistic features of interjections in english and vietnamese

A study of linguistic features of interjections in english and vietnamese

... ôi 2. 2 .1 Review of Speech act Theory dào, ôi chao, i gi i ơi, ch t, ch t th t, b m , h , hé…thư ng ñư c 2. 2 .1. 1 Speech act g i thán t hay c m thán t ” 2. 2 .1 .2 Speech act classification 2. 2 .2. 2 ... classification 2. 2 .2. 2 Interjections in Films 2. 2 .2 Interjections as speech act 2. 2 .2. 3 Felicity conditions for interjections 2. 2 .2. 1 Definition of Interjections 2. 2 .2. 4 Conversational implicature The definition ... Besides, in the process of the 2. 2.3.4 Face Threatening Acts (FTA) study 2. 2.3.5 Politeness strategies for doing FTA 3 .2 RESEARCH PROCEDURES 2. 2.3.6 Mitigation 2. 2.3.7 Context 2. 3 SUMMARY Chapter...

Ngày tải lên: 26/11/2013, 13:25

13 862 0
Tài liệu Oracle Database 10g - New Features For Administrators .Vol 1 ppt

Tài liệu Oracle Database 10g - New Features For Administrators .Vol 1 ppt

... in SQL 21 -18 Case- and Accent-Insensitive Query and Sort 21 -19 Changes in Configuration Parameters 21 -20 Support in SQL and Functions 21 - 21 Quote Operator q 21 -22 UTL_MAIL Package 21 -23 xx UTL_MAIL: ... Concurrency 21 - 12 Large Object (LOB) Data Type Changes 21 -13 Implicit Conversion Between CLOB and NCLOB 21 -14 Regular Expression Support 21 -15 Matching Mechanism 21 -16 Syntax: Example 21 -17 Using ... Overview 12 - 17 Running the Segment Advisor Manually 12 - 18 Using the Segment Advisor with EM 12 - 19 Growth Trend Report 12 - 20 Segment Resource Estimation 12 - 21 Undo Management Page 12 - 22 Undo Advisor...

Ngày tải lên: 16/01/2014, 18:20

284 497 1
Tài liệu Báo cáo khoa học: Functional hierarchy of plasminogen kringles 1 and 4 in fibrinolysis and plasmin-induced cell detachment and apoptosis docx

Tài liệu Báo cáo khoa học: Functional hierarchy of plasminogen kringles 1 and 4 in fibrinolysis and plasmin-induced cell detachment and apoptosis docx

... respectively, cells and fibrin: A10 .2 ¼ 9 .2 nM and nM; 34D3 ¼ 13 .1 nM and nM; mAb mix ¼ 11 .8 nM and nM K4-LBS is permanently exposed, supports this hypothesis Blockage by mAb A10 .2 of K4-LBS exposed ... fibrin and fibrinogen J Biol Chem 25 8, 424 9– 425 6 22 Knudsen BS, Silverstein RL, Leung LL, Harpel PC & Nachman RL (19 86) Binding of plasminogen to extracellular matrix J Biol Chem 26 1, 10 765 10 7 71 23 ... Chem 25 7, 21 04 21 10 41 Markus G, DePasquale JL & Wissler FC (19 78) Quantitative determination of the binding of epsilon-aminocaproic acid to native plasminogen J Biol Chem 25 3, 727 –7 32 42 Markus...

Ngày tải lên: 20/02/2014, 01:20

14 559 0
Báo cáo " Grammatical and semantic features of some English words and idioms denoting happiness - the feeling of great pleasure " potx

Báo cáo " Grammatical and semantic features of some English words and idioms denoting happiness - the feeling of great pleasure " potx

... 16 6 N.T.V Lam / VNU Journal of Science, Foreign Languages 25 (20 09) 16 5 -17 3 2. 1 ‘Delighted’ 2. 1. 1 Grammatical Features and Semantics of ‘Delighted’ ‘Delighted’ is ... ePrint 5.0 now N.T.V Lam / VNU Journal of Science, Foreign Languages 25 (20 09) 16 5 -17 3 17 1 great delight and pleasure, often at the defeat or failure of someone else, celebrate”, as in: The ... copy of ePrint 5.0 now 1 72 N.T.V Lam / VNU Journal of Science, Foreign Languages 25 (20 09) 16 5 -17 3 He was on cloud nine after winning the competition ‘On top of the world’ denotes the property of...

Ngày tải lên: 05/03/2014, 12:20

9 526 4
A New Map of Hollywood: The Production and Distribution of American Motion Pictures pot

A New Map of Hollywood: The Production and Distribution of American Motion Pictures pot

... and Pacific 10 ·3 8·3 — — 22 1 3·4 11 ·5 0·8 0·5 18 ·3 4·8 8·7 1 8 0·7 19 ·3 4·6 7·7 1 1 1 1 17·4 Brazil Canada Mexico Americas — 10 ·4 1 3 17 ·9 0·8 8·7 0·9 12 5 2 2 6·8 1 3 13 ·0 2 9 5 2 1 8 13 ·0 South ... Majors 10 2 7·5 10 ·0 15 2 — — 10 ·6 60·3 8·6 9·6 7·3 17 ·5 5 1 1·8 11 ·0 66·5 8·6 10 ·5 4·7 17 ·4 5·9 1 4 9·8 64·9 7·8 13 2 5·3 11 ·5 6·6 1 2 13 ·4 65·5 Australia Japan Republic of Korea Taiwan Asia and ... of American Motion Pictures Table Feature films released in the US by majors and independents1 Releases Year Majors Independents Total 19 80 19 85 19 90 19 95 20 00 13 4 13 8 15 8 21 2 19 1 57 25 1 22 7 15 8...

Ngày tải lên: 07/03/2014, 15:20

19 705 0
Báo cáo Y học: Structural and serological relatedness of the O-antigens of Proteus penneri 1 and 4 from a novel Proteus serogroup O72 pptx

Báo cáo Y học: Structural and serological relatedness of the O-antigens of Proteus penneri 1 and 4 from a novel Proteus serogroup O72 pptx

... penneri strain 40 41 25 600 < 10 0 < 10 0 320 0 320 0 25 600 < 10 0 < 10 0 320 0 320 0 12 8 00 < 10 0 < 10 0 < 10 0 < 10 0 12 8 00 < 10 0 < 10 0 < 10 0 < 10 0 6400 < 10 0 < 10 0 5 12 0 0 6400 < 10 0 < 10 0 NT NT < 10 0 NT NT O-antiserum ... b-D-GalpNAcII- (1 ® a-D-GlcpII- (1 ® C1 C2 C3 C4 C5 C6 10 5.6 1 02. 6 99.7 74.3 52. 5 68.8 76.9 81. 6 81. 3 70.4 69 .2 77 .1 75.4 75.7 71. 5 66.8 61. 9 62. 2 10 5 .1 54 .1 72. 5 69 .1 76 .2 62. 5 10 5.6 1 02. 6 99.8 74.3 52. 4 ... 25 600 25 600 12 8 00 12 8 00 31. 7 15 .8 25 0.0 25 0.0 0.5 0.5 7.8 7.8 25 6000 1 024 000 10 00 10 00 6400 5 12 0 0 10 0 10 0 12 5 .0 7.9 > 10 00 > 10 00 > 10 00 > 10 00 Table Passive immunohemolysis of the alkali-treated...

Ngày tải lên: 17/03/2014, 17:20

6 563 0
Báo cáo khoa học: Inhibitors of protein phosphatase 1 and 2A decrease the level of tubulin carboxypeptidase activity associated with microtubules pptx

Báo cáo khoa học: Inhibitors of protein phosphatase 1 and 2A decrease the level of tubulin carboxypeptidase activity associated with microtubules pptx

... Sugimura, T (19 90) 24 25 26 27 28 29 30 Calyculin A, an inhibitor of protein phosphatases, a potent tumor promoter on CD -1 mouse skin Cancer Res 50, 3 5 21 –3 525 Li, Y.-M & Casida, J.E (19 92) Cantharidin-binding ... inhibitors of PP1 and PP2A [23 ,24 ], showed effects similar to that of OA (Fig 4) Deltamethrin, a specific inhibitor of PP2B [25 ], and phenylarsine oxide, a putative inhibitor of tyrosine phosphatases [26 ], ... IMAGING SYSTEM and, for each condition, the ratio Glu/Tyr was calculated A/B ¼ 0 .17 ± 0.03; C/D ¼ 1 . 21 ± 0 .15 ; E/F ¼ 0 .28 ± 0.04; G/H ¼ 1. 12 ± 0 .17 Each value represents the mean ± SE of four independent...

Ngày tải lên: 23/03/2014, 15:21

9 301 0
The Seven Rays Today - A New Appreciation of the Ageless Wisdom and Esoteric Astrology pdf

The Seven Rays Today - A New Appreciation of the Ageless Wisdom and Esoteric Astrology pdf

... of Relationship ~ 53 CHAPTER Angles and Astrology ~ 91 CHAPTER Devas, Angles and Centres ~ 13 1 CHAPTER Centres and Polarisation ~ 16 7 CHAPTER The Rays and Human Centres ~ 20 7 CHAPTER Angles and ... Seven 11 THE SEVEN RAYS TODAY Rays and the Seven Planes These, in turn, relate to the Lords of Flame, the Lords of Mind and the Lords of Form respectively, see Diagram One on page 13 12 THE SEVEN ... TODAY 26 THE SEVEN RAYS TODAY TABLE A THE RAYS & THE PLANES 1ST RAY OF WILL (sub-atomic/energy) 1ST PLANE OF SPIRITUAL INTENT 2ND RAY OF LOVE (atomic/light) 2ND PLANE OF SPIRITUAL LOVE 3RD RAY OF...

Ngày tải lên: 28/03/2014, 23:20

386 560 1
báo cáo hóa học:" Gene and microRNA analysis of neutrophils from patients with polycythemia vera and essential thrombocytosis: down-regulation of micro RNA-1 and -133a" pot

báo cáo hóa học:" Gene and microRNA analysis of neutrophils from patients with polycythemia vera and essential thrombocytosis: down-regulation of micro RNA-1 and -133a" pot

... 27 .8 1, 1 81 ± 10 91 8, 4 21 ± 2, 684 930, 916 ± 650, 0 21 527 ,593 ± 45 ,14 17 338 ± 330 10 9.0 ± 52. 9 1, 9 62 ± 1, 665 39.4 ± 32. 1 0.0 12 3 0. 014 5 0. 018 5 0. 019 0 0. 022 0 0. 020 9 0. 024 9 0. 026 3 0.03 52 0.03 81 0.0 4 21 ... hsa-miR -19 a hsa-miR -20 0b hsa-miR-5 42- 3p hsa-mir- 625 hsa-miR -10 6b hsa-miR -20 b 4 .11 2. 63 2. 47 2. 43 2. 21 1.93 1. 92 1. 86 1. 86 1. 81 1.76 1. 73 1. 70 1. 66 1. 63 1. 6 1. 48 1. 43 1. 42 1. 33 1. 31 hsa-miR -13 3a hsa-miR-504 ... P 1, 707 , 21 1 ± 5,080 716 ± 19 5 62. 6 ± 9.9 54 .1 ± 63 .1 5 , 21 5 ± 1, 606 28 7,485 ± 89,954 13 1,558 ± 35 ,29 8 21 .0 ± 13 .0 61. 1 ± 7.5 473 .1 ± 23 9 11 .1 ± 6.5 10 ,467, 524 ± 7,793,493 1, 6 72 ± 854 93.5 ± 27 .8...

Ngày tải lên: 18/06/2014, 15:20

17 526 0
Báo cáo hóa học: " A new interpretation of Jensen’s inequality and geometric properties of -means" pptx

Báo cáo hóa học: " A new interpretation of Jensen’s inequality and geometric properties of -means" pptx

... below) the graph of  Page of 15 Nakasuji et al Journal of Inequalities and Applications 20 11 , 20 11 :48 http://www.journalofinequalitiesandapplications.com/content /20 11 /1/ 48 Page of 15 Here I° denotes ... doi :10 .11 55/S1 025 58349800 025 3 doi :10 .11 86 /1 029 -24 2X -20 11 -48 Cite this article as: Nakasuji et al.: A new interpretation of Jensen’s inequality and geometric properties of -means Journal of Inequalities and ... λc,ξs1 ,ξs2 (x) = s2 λc,ϕ,ψ (x) + − s2 (s1 = 0) (3) and λc,ξs1 ,ξs2 (x) = s2 s − s1 − s1 s1 λc,ϕ,ψ (x) − s1 1 s1 (s1 = 0) (4) for each x Î I\{c} If s1 = 0, then it is trivial by (3) that λc,ξs1...

Ngày tải lên: 21/06/2014, 00:20

15 357 0
báo cáo khoa học: " New sources of soybean seed meal and oil composition traits identified through TILLING" docx

báo cáo khoa học: " New sources of soybean seed meal and oil composition traits identified through TILLING" docx

... Ribozyme termination of RNA transcripts Page 10 of 11 (page number not for citation purposes) BMC Plant Biology 20 09, 9:89 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 down-regulate ... VAMYREAKECIYVEPDREGDKKGVYWYNNKL * B FAD2-1a 615 GmFAD2-1A GmFAD2-1B GmFAD2-2A GmFAD2-2B AtFAD2 C FAD2-1a743 GmFAD2-1A GmFAD2-1B GmFAD2-2A GmFAD2-2B AtFAD2 D * Figure soybean2 fatty acid desaturase (FAD2) amino acid sequence ... Biology 20 09, 9:89 http://www.biomedcentral.com /14 71 -22 29/9/89 70.00 Fatty acid (percent of total) 60.00 50.00 40.00 FAD2-1aa FAD2-1AA 30.00 20 .00 10 .00 0.00 16 :0 18 :0 18 :1 18 :2 18 :3 Figure of S 117 N...

Ngày tải lên: 12/08/2014, 03:20

11 276 0
w