name two devices that are both input and output

Tài liệu Báo cáo khoa học: Molecular and biochemical characterization ofD-phosphoglycerate dehydrogenase fromEntamoeba histolytica A unique enteric protozoan parasite that possesses both phosphorylated and nonphosphorylated serine metabolic pathways docx

Tài liệu Báo cáo khoa học: Molecular and biochemical characterization ofD-phosphoglycerate dehydrogenase fromEntamoeba histolytica A unique enteric protozoan parasite that possesses both phosphorylated and nonphosphorylated serine metabolic pathways docx

... involved in amino acid synthesis of Ser from Gly and Ala from Cys and conversions between Asp and Asn and between Glu and Gln [49]. Serine metabolic pathways are often absent in parasitic protists; the ... mentioned above, apparently lack both of the serine pathways based on their genome data. There are two exceptions: E. histolytica possesses both serine metabolic pathways, and Leishmania has the ... Actinomycetales and archaebacteria belong to Type I, while b-andc-proteobacteria and Bacteroidales belong to Type IIA and Type III, respectively. It is worth noting that Bacillales are not monophyletic...

Ngày tải lên: 19/02/2014, 13:20

12 464 0
Tài liệu Smart Posters - How to use NFC tags and readers to create interactive experiences that benefit both consumers and businesses docx

Tài liệu Smart Posters - How to use NFC tags and readers to create interactive experiences that benefit both consumers and businesses docx

... placed, are an easy way for both service providers and consumers to access the benets of NFC. The NFC Forum recognizes that there are many business models for the technology, and the use cases are ... is in northwest Finland and has over 200,000 inhabitants. It is the fastest-growing region in Finland, and it boasts world-class standards in information technology networks and services. Its ... There are basically two types of tags, passive and active. A passive tag is a stand-alone component. It must be powered by the inquiring NFC device that is operating in Reader/Writer mode, so that...

Ngày tải lên: 21/02/2014, 05:20

25 591 0
Báo cáo khoa học: An ‘Old World’ scorpion b-toxin that recognizes both insect and mammalian sodium channels A possible link towards diversification of b-toxins ppt

Báo cáo khoa học: An ‘Old World’ scorpion b-toxin that recognizes both insect and mammalian sodium channels A possible link towards diversification of b-toxins ppt

... noxius) are highly effective on crustaceans [9–12]; Ts7 and Tst1 (from Tityus serrulatus and T. stig- murus), and Tbs1 and Tbs2 (from T. bahiensis )are highly effective on both insects and mammals ... channels (NaCh) are polypeptides of 61–76 amino acids long that traditionally are divided between two major classes, a and b, according to their physiological effects on channel gating and their binding ... and characterization of an ÔOld WorldÕ toxin, Lqhb1 that probably belongs to the same group as AahIT4 if sequence similarity and binding features are examined 5 .Lqhb1 competes with both a- and...

Ngày tải lên: 31/03/2014, 01:20

8 393 0
Input and output

Input and output

... files and providing pointers for them. These files are the standard input, the standard output, and the standard error; the corresponding file pointers are called stdin, stdout, and stderr, and are ... *fp) Although output errors are rare, they do occur (for example, if a disk fills up), so a production program should check this as well. 124 Chapter 7 - Input and Output Input and output are not ... should take care to return sensible, useful status values. 7.7 Line Input and Output The standard library provides an input and output routine fgets that is similar to the getline function that we...

Ngày tải lên: 30/09/2013, 06:20

14 555 0
Input and output of dissolved organic and inorganic nitrogen in subtropical forests of South China under high air pollution docx

Input and output of dissolved organic and inorganic nitrogen in subtropical forests of South China under high air pollution docx

... climates have shown that DON can comprise about 50%10 or more of the TDN flux in throughfall, soil leachate, and streamwater in both low and moderate N deposition areas (Perakis and Hedin, 2002; ... reported for areas in southern China with rapid economic growth (Fan and Hong, 2001; Zhang, 2006; Chen and Mulder, 2007a; Luo et al., 2007), and it 4137 BGD 4, 4135–4171, 2007 Input- output of N ... the old-growth being doubled than the other two (Ta- ble 3). In the two young forests, 22 and 28 kg N ha −1 yr −1 or 41% and 55% of pre- cipitation TDN input in 2005 was retained in the upper 20...

Ngày tải lên: 23/03/2014, 00:20

37 535 0
Chapter 2Communicating Over the Network Quangkien@gmail.com.OverviewDescribe the structure of a network, including the devices and media that are necessary for successful communications. Explain the function of protocols in network communications. Ex potx

Chapter 2Communicating Over the Network Quangkien@gmail.com.OverviewDescribe the structure of a network, including the devices and media that are necessary for successful communications. Explain the function of protocols in network communications. Ex potx

... internetwork. Examples of intermediary network devices are: 14 Examples of intermediary network devices are: – Network Access Devices (Hubs, switches, and wireless access points). – Internetworking ... Regenerate and retransmit data signals. – Maintain information about what pathways exist through the network and internetwork. 15 and internetwork. – Notify other devices of errors and communication ... locations. Voice and data on separate networks or converged networks Using Layered Protocols Intermediary Devices and their Role on the Network  Processes running on the intermediary network devices...

Ngày tải lên: 01/04/2014, 12:20

52 552 0
Tài liệu Edit Data and Update Changes That Are Made to an ADO.NET pdf

Tài liệu Edit Data and Update Changes That Are Made to an ADO.NET pdf

... TextBox Name txtCustomerID TextBox Name txtCompanyName TextBox Name txtContact TextBox Name txtContactTitle TextBox Name txtAddress TextBox Name txtCity TextBox Name txtRegion TextBox Name ... txtPostalCode TextBox Name txtCountry TextBox Name txtPhone TextBox Name txtFax Button Name Caption btnEdit &Edit Button Name Caption btnSave &Save Button Name Caption btnCancel ... DataTable objects. CommandBuilde r GetUpdateComman d Creates an Update command and places it into the data adapter's UpdateCommand property. DataAdapter UpdateCommand Holds the SQL statement...

Ngày tải lên: 24/12/2013, 06:17

10 401 0
Tài liệu Báo cáo khoa học: Transactivation properties of c-Myb are critically dependent on two SUMO-1 acceptor sites that are conjugated in a PIASy enhanced manner pptx

Tài liệu Báo cáo khoa học: Transactivation properties of c-Myb are critically dependent on two SUMO-1 acceptor sites that are conjugated in a PIASy enhanced manner pptx

... c-Myb is a good substrate for SUMO-1 conjugation and that modification of the two sites are interdependent, and (c) a two- hybrid screening shows that the SUMO-1 conjugase Ubc9 is one of a few major ... c-Myb and GFP-tagged SUMO-1, two retarded doublet bands were observed (Fig. 1A, lane 3). These totally disappeared when the two putative sumoyla- tion sites (in human c-Myb K503 and K527) were both mutated ... cells and transfected CV-1 cells. Analysis in an in vitro conjugation system showed that modification of the two sites K503 and K527 is interdependent. A two- hybrid screening revealed that the...

Ngày tải lên: 21/02/2014, 00:20

11 558 0
Báo cáo khoa học: The signature amidase from Sulfolobus solfataricus belongs to the CX3C subgroup of enzymes cleaving both amides and nitriles Ser195 and Cys145 are predicted to be the active site nucleophiles pot

Báo cáo khoa học: The signature amidase from Sulfolobus solfataricus belongs to the CX3C subgroup of enzymes cleaving both amides and nitriles Ser195 and Cys145 are predicted to be the active site nucleophiles pot

... enzymes cleaving both amides and nitriles Ser195 and Cys145 are predicted to be the active site nucleophiles Elisa Cilia 1,2 , Armando Fabbri 1 , Monica Uriani 1 , Giuseppe G. Scialdone 1 and Sergio ... remains active at 70 °C for about 6 days and has a half-life of 5 h at 95 °C (data not shown). We found that SsAH-WT is able to convert both amides and nitriles, and in particular benzonitrile (Table ... from S. solfataricus. The side chains of the putative catalytic residues are shown. Ser171 and Lys96, shared by the two triads are in red. 141 145 171 P95896 PHMDATVVSRILDEAGEIVAKTTCEDLCFSGGSHTSYPWPVLNPRNPEYMAGGSSSGSAV...

Ngày tải lên: 07/03/2014, 21:20

9 481 0
Báo cáo khoa học: Cytosolic phospholipase A2-a and cyclooxygenase-2 localize to intracellular membranes of EA.hy.926 endothelial cells that are distinct from the endoplasmic reticulum and the Golgi apparatus pdf

Báo cáo khoa học: Cytosolic phospholipase A2-a and cyclooxygenase-2 localize to intracellular membranes of EA.hy.926 endothelial cells that are distinct from the endoplasmic reticulum and the Golgi apparatus pdf

... against COX-1 and COX-2 proteins. Both COX isoforms have been shown to be constitutively localized on both the inner and outer sur- faces of the nuclear membrane [14], and recently, COX-1 and prostacyclin ... to both COX-1 and COX-2 to produce prostaglandin E 2 [51]. The physical colocalization of COX and cPLA 2 -a in these systems, however, has not been studied, and this is one of few studies that ... immunofluorescence microscopy, the location and relocation of cPLA 2 -a in EA.hy.926 was shown to be analogous to that seen in both HUVECs and other endothelial cells [26,27]. Therefore, it is apparent that this hybrid...

Ngày tải lên: 16/03/2014, 18:20

13 388 0
Báo cáo Y học: Nuclear proteins that bind to metal response element a (MREa) in the Wilson disease gene promoter are Ku autoantigens and the Ku-80 subunit is necessary for basal transcription of the WD gene ppt

Báo cáo Y học: Nuclear proteins that bind to metal response element a (MREa) in the Wilson disease gene promoter are Ku autoantigens and the Ku-80 subunit is necessary for basal transcription of the WD gene ppt

... purified and characterized the MREa-binding activity, which consisted of two polypeptides of approximately 70 and 82 kDa. N-terminal and internal amino acid sequencing and immuno analyses revealed that ... WD gene are indicated in Fig. 1. The four MREs are located in the proximal region of the WD gene promoter between )434 and +114, with MREa and MREe in the forward orientation, and MREc and MREd ... Ku-70 and Ku-80 revealed that the MREa-binding proteins described herein and the Ku proteins are immunologically related. The Ku protein complex is known to contain equimolar amounts of the 70- and...

Ngày tải lên: 17/03/2014, 23:20

11 630 0
Authoring and Generating Health-Education Documents That Are Tailored to the Needs of the Individual Patient doc

Authoring and Generating Health-Education Documents That Are Tailored to the Needs of the Individual Patient doc

... rhetorical and corefer- ential links between them, and the conditions under which each element should be included in the output. The elements of the text are typed into the authoring tool, and are marked ... content of the brochure and manner of expression of that content may be determined by both the patient’s medical conditionand any otherpersonaland culturalcharacteristics that mighteither be included in ... creation of tailored Web pages and interactive, hypertext-like health-education systems that we and others are developing (e.g., DiMarco and Foster, 1997; Cawsey, Binsted, and Jones, 1995; Buchanan...

Ngày tải lên: 22/03/2014, 15:21

12 379 0
Báo cáo khoa học: Sodium pump a1 and a3 subunit isoforms mediate distinct responses to ouabain and are both essential for survival of human neuroblastoma docx

Báo cáo khoa học: Sodium pump a1 and a3 subunit isoforms mediate distinct responses to ouabain and are both essential for survival of human neuroblastoma docx

... in exchange for two K + ions that are brought into the cytosol. This activity can be interrupted by a group of substances that are referred to as cardiotonic steroids (CTS), a name linked to their ... structures of a1 ⁄ a2 and a1 ⁄ a3 subunits revealed that surface-exposed areas of the a2ora3 isoforms were very different from the corresponding areas of the a1 isoform [29]. These areas are found mainly ... survival, and that the a1 and a3 isoforms have distinct roles in SK-N-AS cells and loss of one cannot be compensated by the other. Based on these and previous findings, it is possible to speculate that...

Ngày tải lên: 29/03/2014, 09:20

8 207 0
extraction of liquid crystals from flat panel display devices using both liquid and supercritical carbon dioxide

extraction of liquid crystals from flat panel display devices using both liquid and supercritical carbon dioxide

... Herein we demonstrate that both liquid and supercritical carbon dioxide are effective and environmentally benign solvents for extraction of liquid crystals from display devices. Typically the ... [1] has meant that devices such as flat panel displays can no longer be disposed of by landfill. Current methods for disposal and/ or recycling of these valuable waste resources are at best limited. ... harmful to the environment and costly. It is estimated that 2.5 billion LCDs are approaching their end of life and conservative predictions on the growth in sales of LCDs are 16-28% every five years,...

Ngày tải lên: 28/04/2014, 10:50

6 308 0
w