... Optimizing Rehabilitation Outcomes J Telemed & E-Health 2004, 10:200-212 Hamilton BB, et al.: A uniform national data system for medical rehabilitation In Rehabilitation outcomes: analysis and measurement ... large robotic systems or three dimensional (3D) marker-based motion analysis systems as their research platform While these tools provide abundant sensor-based performance data, high costs and ... sensitivity for use as assessment tools for a home rehabilitation as a component within a larger-scale biomechatronic system A key question relates to which of the many viable metrics are most effective...
Ngày tải lên: 19/06/2014, 08:20
... where, as in traditional ASR, we have an acoustic model Pr(x | p, s) and a language model Pr(s | p) The main difference is that, here, part of the correct transcription is available (prefix) and ... results should be corroborated by performing a formal usability evaluation Currently, we are in the process of carrying out a formal usability evaluation with real users that has been designed following ... Interfaces and the 7th International Workshop on Machine Learning for Multimodal Interaction, ICMI-MLMI A. H Toselli, E Vidal, and F Casacuberta 2011 Multimodal Interactive Pattern Recognition and Applications...
Ngày tải lên: 08/03/2014, 21:20
Báo cáo khoa học: "SOFTWARE TOOLS FOR THE ENVIRONMENT OF A COMPUTER AIDED TRANSLATION SYSTEM" pptx
... a CAT system) For any given source lexical unit in this data base, VISULEX searches for all the associated information THAM consists of a set of functions programmed in the macro language associated ... translation is always done by the translator This data base is composed of dictionaries, "formats" and "procedures" of the analysis, transfer and synthesis phases (the conventional phases of a ... - - as a debugging tool for linguistic applications ; as a tool for converting the lexical base into a new form (for instance, loading it into a conventional data base) It is possible to imagine...
Ngày tải lên: 17/03/2014, 19:21
báo cáo khoa học: " Potential of a suite of robot/computer-assisted motivating systems for personalized, home-based, stroke rehabilitation" pdf
... horizontal and vertical configurations, each within multiple areas of the arm workspace Data and statistical analysis The data was analyzed across subjects within the same experiments For analysis, ... suggest that the Robot/CAMR suite has potential for stroke rehabilitation and by manipulating hardware and software variables we can create therapy that will meet patients' therapeutic needs and potentially ... commercial hardware to assess and motivate arm use Our approach also uses commercially available, gamebased activities and custom assessment activities along with tele-supported clinical interactions...
Ngày tải lên: 11/08/2014, 14:20
PERFORMANCE OF A COMBINED CONSTRUCTED WETLAND SYSTEM FOR TREATING VILLAGE SEWAGE IN LAKE DIANCHI VALLEY
... the pollutants concentration was low in the rain season (from May to October) The data from the local weather station showed that the average annual rainfall and evaporation was 802mm and 2093mm, ... order to make full use of the land advantage to strengthen ecological and scenical effect of ecological system The area was 2000 m2 and hydraulic loading rate was 4cm/d in the free-surface constructed ... domestic wastewater in Lake Dianchi Valley., Proceedings of Asian waterqual’2003, IWA Asia-Pacific Regional conference, Abstract on pp 70, Paper on CD-ROM, Bangkok Liu, C.X., Hu, H.-Y., Huang, X.,...
Ngày tải lên: 05/09/2013, 08:40
A distributed decision support system for building evacuation 2009
... translated in a full knowledge of the building graph and a calculation of the shortest paths by using Dijkstra’s algorithm An evacuee becomes aware of a hazardous area when it reaches a location ... hazard A low value indicates that the system has succeeded in directing the evacuees along safe paths, avoiding the hazardous locations • Percentage of fatally injured evacuees This is a straightforward ... building’s structure before the hazard starts spreading We consider that the evacuees are familiar with all the available exits and are able to follow the shortest paths that lead to them In terms...
Ngày tải lên: 07/12/2013, 11:41
PROBE–A multicriteria decision support system for portfolio robustness evaluation
... Analysis with Spreadsheets Duxbury Press, Belmont, CA Kleinmuntz, C.E., Kleinmuntz, D.N., 1999 A strategic approach to allocating capital in healthcare organizations Healthcare Financial Management, ... multicriteria value analysis and decision conferencing: A case study International Transactions in Operational Research, 13(4), 279-297 Bana e Costa, C .A. , Lourenço, J.C., Soares, J.O., 2007 An interval ... References Bana e Costa, C .A. , 1990 An additive value function technique with a fuzzy outranking relation for dealing with poor intercriteria preference information In C .A Bana e Costa, ed Readings...
Ngày tải lên: 07/12/2013, 11:41
Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc
... 277 283 TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK *****::*.** : ... Toyobo (Osaka, Japan) Emulgen 911 was a gift from Kao Chemical (Tokyo, Japan) NADPH, NADH and NADP+ were purchased from Oriental Yeast (Tokyo, Japan) a- Cyano-4-hydroxycinnamic acid was obtained from ... :.:: : * : * NAYTAKAVIIAAGVGAFEPRRIGAPGEREFEGRGVYYAVKSKA-EFQGK-RVLIVGGGDS -EYTCDALIIATGASA -RYLGLPSEEAFKGRGVSACATCDG-FFYRNQKVAVIGGGNT LEVKARTVILAVGSRR -RKLGVPGEAELAGRGVSYCSVCDAPLFKGKDAVVVVGGGDS...
Ngày tải lên: 18/02/2014, 08:20
Tài liệu Báo cáo khoa học: "MemeTube: A Sentiment-based Audiovisual System for Analyzing and Displaying Microblog Messages" pdf
... We also integrate the sentiment-detection system with a real-time rule-based harmonic music and animation generator to display streams of messages in an audiovisual format Conceptually, our system ... similar to what many people have proposed for evaluation (Davidov et al 2010; Sun et al 2010; Bifet and Frank 2010; Go et al 2009; Pak and Paroubek 2010; Chen et al 2010) We use data from January ... playing Animation Generation In this final stage, our system produces real-time animation for visualization The streams of messages are designed to flow as if they were playing a piece of a piano...
Ngày tải lên: 20/02/2014, 05:20
Báo cáo khoa học: "A Broad-Coverage Normalization System for Social Media Language" pot
... normalization problem was also tackled under the machine transla- tion (MT) or speech recognition (ASR) framework (Aw et al., 2006) adapted a phrase-based MT model for normalizing SMS and achieved ... SMS and Twitter data sets to evaluate the system effectiveness Statistics of these data sets are summarized in Table Data set (1) to (3) are used for word-level evaluation; data set (4) for both ... that the broad-coverage system outperforms all other systems on the reported data sets It achieves about 90% word-level accuracy on data set (1) and (2) with the top-10 candidates (an average...
Ngày tải lên: 07/03/2014, 18:20
Báo cáo khoa học: "A Modular Open-Source System for Recognizing Textual Entailment" pot
... Greental, and Eyal Shnarch 2007 Semantic inference at the lexicalsyntactic level In Proceedings of AAAI Luisa Bentivogli, Peter Clark, Ido Dagan, Hoa Dang, and Danilo Giampiccolo 2010 The sixth pascal ... mechanism A plug-in is a piece of code which implements a few interfaces that detect which transformations can be applied, apply them, and construct appropriate feature-vectors for each applied transformation ... the transformation, highlighting the impact of this transformation In manual mode, the user can invoke specific transformations proactively, including transformations rejected by the search algorithm...
Ngày tải lên: 07/03/2014, 18:20
Báo cáo khoa học: "A Multi-Document Summarization System for Scientific Article" docx
... user a multi-document summary typical evaluation of a multi-document summarization system, gold standard summaries are created by hand and then compared against fixed length generated summaries ... domain of scientific article summarization, we used a widely used and freely available multi-document summarization system called MEAD (Radev, 2004) as our baseline MEAD uses centroid based summarization ... extraction, utility based evaluation, and user studies In NAACL-ANLP 2000 Workshop on Automatic summarization, pages 21-30, Morristown, NJ, USA [12, 16, 17] Radev, Dragomir 2004 MEAD - a platform...
Ngày tải lên: 17/03/2014, 00:20
Báo cáo khoa học: "An Innovative Computer-Assisted Translation System" docx
... of a successful cooperation between European countries and Canada to develop an innovative approach to machine aided translation It is based on advances in statistical machine translation research ... keyboard This picture displays in red (appearing in gray in black and white) characters that have been suggested and accepted by the translator TT2 as seen by a translator TransType is a tool that ... interface have opted for JAVA as the programming language because of its graphical user capabilities, in particular its text components, which are fully configurable and compatible with external...
Ngày tải lên: 17/03/2014, 06:20
NiagaraCQ: A Scalable Continuous Query System for Internet Databases ppt
... demonstrate in Section 4, very scalable NIAGARACQ COMMAND LANGUAGE NiagaraCQ defines a simple command language for creating and dropping continuous queries The command to create a continuous query has ... contains a brief discussion of the caching mechanisms in NiagaraCQ to make the system more scalable NiagaraCQ is the continuous query sub -system of the Niagara project, which is a net data management ... 4.1 System Architecture Figure 4.1 shows the architecture of Niagara system NiagaraCQ is a sub -system of Niagara that handles continuous queries NiagaraCQ consists of A continuous query manager,...
Ngày tải lên: 23/03/2014, 03:20
Báo cáo "Designing a low-cost WebGIS system for deliviering land information via internet " potx
Ngày tải lên: 28/03/2014, 15:20
iCare: A Mobile Health Monitoring System for the Elderly pptx
... personal health information system and the medical guidance 1) Personal health information system: The personal health system can store physiological data and other information in the database ... system can act as the personal health information system on the server The smart phone gets physiological data from sensors, and locally stores physiological data and other information such as ... in acting as a living assistant It provides auxiliary functions as the living assistant, including e.g regular reminder, quick alarm At the same time, iCare also acts as the personal health information...
Ngày tải lên: 28/03/2014, 19:21
Báo cáo sinh học: "Comparisons of three polyethyleneimine-derived nanoparticles as a gene therapy delivery system for renal cell carcinoma" doc
... Sugiyama A, Kume H, Ota S, Kashima T, Tomita K, Kitamura T, Kodama T, Fukayama M, Aburatani H: Identification of Toll-like receptor as a potential therapeutic target in clear cell renal cell carcinoma ... dissolve the MTT-formazan crystals The absorbance was measured at 490 nm by an ELISA microplate reader (Bio-Rad) Besides that, the toxicity on Ana-1 and HUVEC cells were evaluated with the same method ... physic-chemical properties (size and charge) of each separate material, including PCFC-g-PEI and FA-PEAs, as well as the FA-PEAs: pVHL complexes Because PCFC-g-PEI and FA-PEAs are amphiphilic...
Ngày tải lên: 18/06/2014, 19:20
Báo cáo hóa học: "Research Article Design of a Versatile and Low Cost μVolt Level A to D Conversion System for Use in Medical Instrumentation Applicatio" pdf
... the case of a hand-held instrument, allows for a “snapshot” of the data stream to be made manually at a time chosen by the operator Use of this additional facility does not interrupt the data stream ... digital format has occurred Achieving reliable analogue amplification and filtering at the ultra low sensor outputs encountered proved to be unproductive in that every analogue stage produced and added ... elements of a long run of coaxial cable SIGNAL RESOLUTION To establish resolution, accuracy, and repeatability of measurements it was necessary to quantify the level of residual noise from the analogue...
Ngày tải lên: 22/06/2014, 01:20