cac bai toan ve phan so toi gian

Human Developmental Toxicants - Part 11 ppt

Human Developmental Toxicants - Part 11 ppt

... Positive Negative Frequency 10 20 30 Solubility parameter 40 Human malformation - solubility parameter Positive Negative Frequency 10 20 30 40 Solubility parameter Human functional deficit - solubility ... Frequency 10 −5 Water solubility 10 Human death - water solubility Positive Negative Frequency 10 −5 Water solubility 10 Human malformation - water solubility Positive Negative Frequency 10 −5 © ... Positive Negative Frequency 0 10 HLB 20 Human developmental toxicants - solubility parameter Frequency 10 20 30 Solubility parameter 40 Human growth retardation - solubility parameter Positive Negative...

Ngày tải lên: 12/08/2014, 00:21

84 238 0
Statistical Description of Data part 1

Statistical Description of Data part 1

... by Cambridge University Press.Programs Copyright (C) 1988-1992 by Numerical Recipes Software Permission is granted for internet users to make one paper copy for their own personal use Further ... Distribution: Mean, Variance, Skewness, and So Forth When a set of values has a sufficiently strong central tendency, that is, a tendency to cluster around some particular value, then it may be useful ... to a theory, parameter estimation, least-squares fits, and so on Those subjects are introduced in Chapter 15 Section 14.1 deals with so- called measures of central tendency, the moments of a distribution,...

Ngày tải lên: 20/10/2013, 17:15

2 268 0
Statistical Description of Data part 2

Statistical Description of Data part 2

... Have the Same Means or Variances? Not uncommonly we want to know whether two distributions have the same mean For example, a first set of measured values may have been gathered before some event, ... is good practice to believe in skewnesses only when they are several or many times as large as this The kurtosis is also a nondimensional quantity It measures the relative peakedness or flatness ... moment(float data[], int n, float *ave, float *adev, float *sdev, float *var, float *skew, float *curt) Given an array of data[1 n], this routine returns its mean ave, average deviation adev, standard...

Ngày tải lên: 24/10/2013, 15:15

6 304 0
Statistical Description of Data part 3

Statistical Description of Data part 3

... void avevar(float data[], unsigned long n, float *ave, float *var); float betai(float a, float b, float x); float var1,var2,svar,df,ave1,ave2; avevar(data1,n1,&ave1,&var1); avevar(data2,n2,&ave2,&var2); ... avevar(float data[], unsigned long n, float *ave, float *var); float betai(float a, float b, float x); unsigned long j; float var1,var2,ave1,ave2,sd,df,cov=0.0; avevar(data1,n,&ave1,&var1); avevar(data2,n,&ave2,&var2); ... formula (14.1.8) 618 Chapter 14 Statistical Description of Data avevar(data1,n1,&ave1,&var1); avevar(data2,n2,&ave2,&var2); *t=(ave1-ave2)/sqrt(var1/n1+var2/n2); df=SQR(var1/n1+var2/n2)/(SQR(var1/n1)/(n1-1)+SQR(var2/n2)/(n2-1));...

Ngày tải lên: 24/10/2013, 15:15

6 374 0
Statistical Description of Data part 4

Statistical Description of Data part 4

... longitude of something agrees with some theory, or whether two somethings have different distributions in longitude (See also [8].) We will leave to you the coding of routines analogous to ksone, kstwo, ... Different distribution functions, or sets of data, give different cumulative distribution function estimates by the above procedure However, all cumulative distribution functions agree at the smallest ... latter variable is in fact dependent on or associated with the former variable If it is, we want to have some quantitative measure of the strength of the association One often hears this loosely stated...

Ngày tải lên: 28/10/2013, 22:15

9 337 0
Statistical Description of Data part 5

Statistical Description of Data part 5

... job of characterizing the significance of association, but is only so- so as a measure of the strength (principally because its numerical values have no very direct interpretations) The second approach, ... The value H is conventionally termed the entropy of the distribution given by the pi ’s, a terminology borrowed from statistical physics So far we have said nothing about the association of two ... entries in that column or row is also zero; in that case, the never-occurring bin of x or y should simply be removed from the analysis The chi-square statistic is now given by equation (14.3.1), which,...

Ngày tải lên: 28/10/2013, 22:15

9 310 0
Statistical Description of Data part 6

Statistical Description of Data part 6

... significance level is given by − A(t|ν) (equation 6.4.7) As N becomes large, this significance and (14.5.2) become asymptotically the same, so that one never does worse by using (14.5.5), even if the ... when they are valid, give several useful statistical tests For example, the significance level at which a measured value of r differs from some hypothesized value rtrue is given by √ |z − z| N − ... measured r1 and r2 have the wrong sense, you have failed to demonstrate your one-sided hypothesis, but (ii) if they have the right ordering, you can multiply the significances given above by 0.5, which...

Ngày tải lên: 07/11/2013, 19:15

4 312 0
Statistical Description of Data part 7

Statistical Description of Data part 7

... vard,t,sg,sf,fac,en3n,en,df,aved,*wksp1,*wksp2; wksp1=vector(1,n); wksp2=vector(1,n); for (j=1;j

Ngày tải lên: 07/11/2013, 19:15

7 360 0
Statistical Description of Data part 8

Statistical Description of Data part 8

... parent However, extensive Monte Carlo integrations have shown that the distribution of the twodimensional D is very nearly identical for even quite different distributions, as long as they have the ... varying and also corrupted by random noise Then it can sometimes be useful to replace each data point by some kind of local average of surrounding data points Since nearby points measure very nearly ... end of the averaging interval are on the average balanced by lower points at the other end A bias is introduced, however, if the underlying function has a nonzero second derivative At a local...

Ngày tải lên: 07/11/2013, 19:15

6 311 0
Tài liệu Description of Functions doc

Tài liệu Description of Functions doc

... mode) S Correct the program Software limit switches Function The software limit switches serve as limitations of the maximum traversing range of each individual axis software limit switch pairs ... DRIVE_AX_RATIO_DENOM(load gear denominator) MD 31060: DRIVE_AX_RATIO_NUMERA(load gear numerator) Gear transmission ratio (encoder), also for spindle if any: MD 31070: DRIVE_ENC_RATIO_DENOM (resolver ... as the 1st software limit switch plus, but for the traversing area limit in the negative direction The MD is active after reference point approach if the PLC interface signal ”2nd software limit...

Ngày tải lên: 13/12/2013, 01:16

411 499 0
Tài liệu Statistical Description of Data part 9 pptx

Tài liệu Statistical Description of Data part 9 pptx

... a[1+(ipj+imj)/2][1+(ipj-imj)/2]=sum; } ludcmp(a,m+1,indx,&d); Solve them: LU decomposition for (j=1;j

Ngày tải lên: 15/12/2013, 04:15

6 407 0
Tài liệu APPENDIX Description of the Extraordinary Measures pdf

Tài liệu APPENDIX Description of the Extraordinary Measures pdf

... investments in the CSRDF, and (2) suspend new investment The Secretary of the Treasury does not have unlimited discretion to declare a debt issuance suspension period Under the statute that governs ... measures Once the extraordinary measures have been exhausted, however, the U.S Government will be limited in its ability to make payments across the government After the debt limit impasse has ... this interest payment would be invested But with the investment suspension authority available, Treasury may suspend the investment of the interest Suspending the investment would free up approximately...

Ngày tải lên: 16/02/2014, 11:20

5 368 0
Tài liệu Lombard Street: A Description of the Money Market docx

Tài liệu Lombard Street: A Description of the Money Market docx

... person you received it from If you received it on a physical medium, you must return it with your note, and such person may choose to alternatively give you a replacement copy If you received ... almost marvellous in its banking development Even, therefore, if the facts so much referred to in 1844 had the importance then ascribed to them, and I believe that in some respects they were even then ... very hard to establish among new people, and not very easy to explain to them Deposit banking is of this sort Its essence is that a very large number of persons agree to trust a very few persons,...

Ngày tải lên: 17/02/2014, 19:20

102 433 0
Tài liệu Báo cáo khoa học: Characterization of ICAM-4 binding to the I domains of the CD11a/CD18 and CD11b/CD18 leukocyte integrins pptx

Tài liệu Báo cáo khoa học: Characterization of ICAM-4 binding to the I domains of the CD11a/CD18 and CD11b/CD18 leukocyte integrins pptx

... as the level of LW expression is greater in RhD-positive than in RhDnegative cells, and extremely rare Rhnull cells, which lack all Rh antigens, are also deficient in the LW protein However, individuals ... weakly However, soluble CD11b I domain readily inhibited the binding of captured ICAM-4Fc to CD11b I domain GST, while the soluble CD11a I domain did not have any effect Furthermore, soluble ICAM-4Fc ... of ICAM-2 and ICAM-4 L cells did so However, at high levels of CD11b I domain fusion proteins, wild-type L cells were adherent as well, a phenomenon noticed also by others for wild-type CHO cells...

Ngày tải lên: 20/02/2014, 11:20

14 497 0
Tài liệu Báo cáo khoa học: "An Implemented Description of Japanese: The Lexeed Dictionary and the Hinoki Treebank" ppt

Tài liệu Báo cáo khoa học: "An Implemented Description of Japanese: The Lexeed Dictionary and the Hinoki Treebank" ppt

... /を/運転1 /す る /人1 /。     Someone who drives a car       H YPERNYM 人1 hito “person”      S EM C LASS 292:chauffeur/driver (⊂ 5:person )     W ORD N ET driver1    D EFINITION ... “driver” ¯ is given in Figure The third reason was that use of the grammar as a base enforces consistency — all sentences annotated are guaranteed to have well-formed parses The last reason was the ... reason was the availability of a reasonably robust existing HPSG of Japanese (JACY), and a wide range of open source tools for developing the grammars We made extensive use of tools from the the Deep...

Ngày tải lên: 20/02/2014, 12:20

4 537 0
Tài liệu The Description of Wales pot

Tài liệu The Description of Wales pot

... great-grandfathers, but even refer back to the sixth or seventh generation, or beyond them, in this manner: Rhys, son of Gruffydd, son of Rhys, son of Tewdwr, son of Eineon, son of Owen, son of Howel, son of Cadell, ... talents have been received; every faculty (say they) ought to be employed in praising him from whom, as from a perennial source, every perfect gift is derived, and from whose bounty everything ... Tewdwr; Tewdwr, son of Eineon; Eineon, son of Owen; Owen, son of Howel Dda, or Howel the Good; Howel, son of Cadell, son of Roderic the Great Thus the princes of South Wales derived their origin...

Ngày tải lên: 21/02/2014, 21:20

28 452 0
Tài liệu Title: Elizabethan England From ''''A Description of England,'''' by William Harrison pptx

Tài liệu Title: Elizabethan England From ''''A Description of England,'''' by William Harrison pptx

... the writing hereof, many know, and peradventure the slackness shewed herein can better testify; but, howsoever it be done, and whatsoever I have done, I have had an especial eye unto the truth ... little impaired, but also their livelihoods and revenues so wasted and consumed that, if at all, yet not in many years, they shall be able to recover themselves It were very good therefore that ... "it is but some woman's garter that hath fallen from her as she followed the queen's majesty." "Whatsoever it be," quoth the king, "take it up and give it me." So when he had received the garter,...

Ngày tải lên: 21/02/2014, 21:20

193 468 0
Báo cáo Y học: Novel fish hypothalamic neuropeptide Cloning of a cDNA encoding the precursor polypeptide and identification and localization of the mature peptide pptx

Báo cáo Y học: Novel fish hypothalamic neuropeptide Cloning of a cDNA encoding the precursor polypeptide and identification and localization of the mature peptide pptx

... mLÆmin)1 The isolated immunoreactive substances (1 mL each) were then subjected to MS analyses as described below After evaporation of the isolated material, the residue was dissolved in 50% methanol ... VKDWAPKIKMNKPVVNKMPPSAANLPLRF-NH2) has been isolated as one of the bovine RFRPs [15] Collectively, these peptides identified from the brain of several vertebrates are characterized by the LPXRF-NH2 ... complementary to a sequence of antisense probe Competitive enzyme-linked immunosorbent assay (ELISA) Because the deduced peptide precursor encoded three putative LPXRFamide peptides [goldfish LPXRFamide peptide-1,...

Ngày tải lên: 08/03/2014, 16:20

9 383 0
History and Comprehensive Description of Loudoun County, Virginia pot

History and Comprehensive Description of Loudoun County, Virginia pot

... 670 slave-holders in the following proportions: slave 124 slaves 84 slaves 61 slaves 83 slaves 46 slaves 39 slaves 35 slaves 27 slaves 22 10 and under 15 slaves 80 15 and under 20 slaves 36 20 ... size from a few inches to several feet in diameter, are also scattered over the surface of the soil Occasional slopes of the type have had the soil covering entirely removed by erosion, and here, ... Comprehensive Description of Loudoun County, Virginia 26 Small quantities of silver ore are discovered from time to time; but the leads have never been extensively worked and many of the richest veins...

Ngày tải lên: 08/03/2014, 22:20

105 266 0
w