a tool for router monitoring and manipulation

... generated after the finalization of a year’s data collection using python-scripts for the calculation and javascript/jquery for the pres-entation of the data The diagrams are based on the stan-dardized ... data set The variables used for the benchmarking and quality indicator calculations were chosen because of their cap-acity to describe clinically important and/or modifiable Table 1 Data analysis ... Neonatal and Paediatric Intensive Care Unit (T M Berger); St Gallen: Cantonal Hospital St Gallen, Department of Neonatology (A Malzacher), Children ’s Hospital St Gallen, Neonatal and Paediatric...

Ngày tải lên: 02/03/2020, 16:44

... and Warwick (1993), addition of flavor can compensate for age-related perceptual losses, improve food palatability and acceptance, and increase intake in the elderly Tuorila, Niskanen, and Maunuksela ... investigation, since there are ambiguous results and evidence for and against on that matter Acknowledgements The authors thank practical trainees Linda van Mierlo and Pascalle Weijzen from Wageningen University, ... Andersson, A ˚ , Martikainen, A., & Salovaara, H (1998) Effect of product formula, information and consumer characteristics on the acceptance of a new snack food Food Quality and Preference,...

Ngày tải lên: 03/04/2013, 21:06

... revealsequivalent degrees of accuracy and detail FluSHELL shows average accuracies of 1.8 °Cand 2.4 °C for the average and maximum temperatures, respectively, and the locations with average deviations ... by magnetic induction, transforms a system of alternating voltage and current intoanother system of alternating voltage and current usually of different values and at other words, each transformer ... Trang 16List of Figuresglued over it: a photograph b schematic representation and turns of each coil: a before assembling and b after assembling transformer: a perpendicular magnetic shunts and...

Ngày tải lên: 27/04/2020, 09:11

... retention time) and peak area values per sample was obtained Statistical analyses Hierarchical Cluster Analysis (HCA) was performed with pvclust package running under R 3.2 and PLS-DA was performed using ... + Annotation level: 1) co-injected with pure standards, 2) annotated matching published data and mass spectral results and 3) annotation made based on mass spectral data, *) tentatively annotated ... literature and co-injection with pure standards when available All stan-dards were purchased from Sigma-Aldrich (Madrid, Spain) except for ABA and derivatives that were ob-tained from the Plant...

Ngày tải lên: 26/05/2020, 23:46

... edges), and their scaffold assembly graph SAG(A1, A2, A3) Scaffold edges are colored black Actual assembly edges are shown as solid, while candidate assembly edges are shown as dashed a Individual ... Individual scaffold assembly graph SAG(A1) b Individual scaffold assembly graph SAG(A2) c Individual scaffold assembly graph SAG(A3) d Scaffold assembly graph SAG(A1, A2, A3) the identically labeled ... Trang 1R E S E A R C H Open AccessCAMSA: a tool for comparative analysis and merging of scaffold assemblies Sergey S Aganezov1,2*and Max A Alekseyev3 From 6th IEEE International Conference...

Ngày tải lên: 25/11/2020, 16:27

... Trang 1A TTrang 2A Tool for Efficient Fertilizer and Water ManagementU Kafkafi and J Tarchitzky International Fertilizer Industry Association (IFA) International Potash Institute (IPI) Paris, ... extension agents and consultants on water quality, soil and water salinity, wastewater use for crop irrigation, agricultural and municipal solid wastes usage for crop nutrition and soil amendments ... implies that larger wet surface areas are exposed to direct water evaporation and to a gradual built up of salt accumulation at the soil surface Repeated frequent irrigation and evaporation cycles,...

Ngày tải lên: 28/01/2021, 07:56

... PHP and perl scripts to annotate and populate the database and worked on database and table design and interaction SMG contributed to manuscript preparation and future database design All authors ... binding site databases The goals and features of the NFI-Regulome database appear unique among TF binding site databases There are a number of databases that are significantly larger than the NFI-Regulome ... extract and use information stored in genome databases, is an essential part of genomic and bioinformatic analysis [1-4] While now primarily a basic research tool, analysis of genome annotation information...

Ngày tải lên: 10/08/2014, 09:22

... distally along the shoe), medial (greater medial than lateral wear at the heel and forefoot), which may indicate excessive pronation, or lateral (greater lateral than medial wear at the heel and forefoot), ... shoes, and sandals. The range for each quantitative measure from the included footwear can be found in Table 1. Intra-rater reliability Intra-rater ICCs and 95% LOAs for quantitative measures are ... order for health professionals to accurately and effi- ciently critique an individual's footwear and provide advice, a valid and reliable footwear assessment tool is required. The availability...

Ngày tải lên: 10/08/2014, 21:23

... captive reindeer calves Materials and methods Animals and experimental design The study was carried out during March 1997 the ration in the morning and the rest at noon Fresh water was available ... has been calculated as an average of individual mean values The box-plot presentation shows the standard median, and 10, 25, 75 and 90 percentiles The square plot presents the average and the outermost ... (Rangifer tarandus tarandus) Acta Physiol Scand 2000, 170, 145-151. Moen AN: Seasonal changes in heart rates, activity, metabolism, and forage intake of white-tailed deer J Wildl Manage 1978, 42(4),...

Ngày tải lên: 12/08/2014, 15:20

... 86853546,86854566 AGCACCGCGCAGGCGCTGCGGAGCCGCGCGGAGGAAGTTTGAACG ATGTGCATTTGTAGAAGTTTGGTCATCTAGCAGAACAGAAAATTA TTCAAAAACTTTCAACAAGCGCGTGACACATGTAGTCTTCAAAGA MESVLKGICAFVEVWSSSRTENYSKAFEQQLLDMGAKVSKTFNKR PAVYNNDGLPLKHKCMQPKDFVEKTPENDRKLQRRLDRMAKELAQ ... @ AtGDB Site Map Tutorial Search: Genome Records Transcript View - AtGDB ^ ID Sim Cov chr gi|| ACTCGAGGATGACACTTCGGCCGATGAGGTACAAGTTTCTTCTATTTGTTTTGGAATAAAGTGTAATCGCCGTGCTTAATGATTTTCCCACAATCGATCAGCAGGATAAGGAGATTGATCTGCCAGAGTCCATT ... concealed in the diagram yrGATE with DAS input DAS servers provide sequence and annotation information that can be queried and is in a standard format [32,33] The abundance of DAS servers for a variety...

Ngày tải lên: 14/08/2014, 16:21

... guys! Aarthi, Daniel and Siva, thank you a lot for working towards the chip designand fabrication It was a nice time to get a chance to know each other andwork together Johnathan and Nillhan it was ... a substrate with micro-fabricated current carryingconductors Micro fabricated wires and electrodes, on an atom chip, generate magneticand electric fields that can be used to trap and manipulate ... micro-opticaldevices and sensors In atomic physics, the atom chip experiments based on neutralatoms or ions are starting to realize a similar scalable quantum optical system An atom chip, at its most basic,...

Ngày tải lên: 08/09/2015, 15:07

... Western Carpathians The area is a part of Magura Flysch Belt (Rača tectonic unit) that is formed of alternating layers of claystones and sandstones of Mesozoic and Paleogene age The area is characterised ... criteria for establishing national geoparks as well as criteria for the temporary status of candidate geopark Today, there are six rytířů and Podbeskydí The candidate geoparks are Vysočina, Ralsko, ... Significant Landscape Component; the landforms and landscapes of larger scale are protected in the category of Natural Parks In these sites and areas special conditions apply in relation to the water...

Ngày tải lên: 30/12/2018, 14:47

... make all resources required for ICP practices available and providing educational (formal and on the job) and motivational programs Alcohol rub procedure was emphasized and dispensers for handrubbing ... Programs in Egyptian Hospitals Fatma Abdelaziz Amer 1* , Ahmed Ashraf Wegdan 2 and Heba AliMohtady 1,3 1 Medical Microbiology and Immunology Department, Zagazig Faculty of Medicine, Zagazig, ... Quality of patient record keeping: an indicator of the quality of care? BMJ QualSaf 20:314–318 How to cite this article: Fatma Abdelaziz Amer, Ahmed Ashraf Wegdan and Heba AliMohtady 2019 A...

Ngày tải lên: 16/01/2020, 00:32

... be: aaa aaa aaa aaa new-model authentication login default tacacs+ enable authentication enable default tacacs+ enable accounting exec start-stop tacacs+ ip tacacs source-interface Loopback0 ... Configuration control and audit of who is done what when on the routers is the key objective for using AAA command accounting on a ISP’s backbone aaa aaa aaa aaa aaa new-model authentication login ... authentication login default tacacs+ enable aaa authentication login Cisco-Lab local enable aaa authentication enable default tacacs+ enable aaa accounting exec start-stop tacacs+ ! username Cisco1 password...

Ngày tải lên: 24/10/2015, 09:15

... Management Agent action form, that is used The metaverse namespace value is available as the $zcMAUNSBase attribute of the management agent BETA MATERIALS FOR MICROSOFT CERTIFIED TRAINER PREPARATION ... User-defined constants Literal text The template language enables data transformations as information moves in and out of the metadirectory Data transformation is required because different directories ... metaverse namespace BETA MATERIALS FOR MICROSOFT CERTIFIED TRAINER PREPARATION PURPOSES ONLY 14 Module 5: Modifying and Creating Templates Standard Operators The standard operators of the template...

Ngày tải lên: 21/12/2013, 19:15

... on and off is a good way to test if the correct layer has been selected Activate the layer’s image by selecting the entire layer area (Ctrl -A for Windows; Cmd -A for Macintosh) and move the layer ... panel After this layer has been selected, the content on the layer will be available for editing Activate the layer’s image by selecting the entire layer area (Ctrl -A for Windows; Cmd -A for Macintosh) ... important for the reader to keep in mind is that templates can and, in most cases, should be modified for specific projects A5 design’s clients don’t always realize that colors and images can be easily...

Ngày tải lên: 17/10/2013, 23:15

... int and double data ob2 uses a character and a character pointer For both cases, the compiler automatically generates the appropriate data and functions to accommodate the way the objects are ... be generalized For example, the same algorithm that maintains a queue of integers will also work for a queue of characters, and the same mechanism that maintains a linked list of mailing addresses ... C++’s dynamic allocation system In this method, storage for data is allocated as needed from the free memory area that lies between your program (and its permanent storage area) and the stack This...

Ngày tải lên: 18/10/2013, 03:15

... skills, and educational background; allows for a great deal of creativity Disadvantages: More time-consuming to organize and difficult to read unless formatted very carefully What Do You Mean by “Formatting”? ... creative and adaptable types of resumes and are the favorite choice of many teacher applicants Advantages: Uses the best ideas from both styles: teaching experience, related experience, activities and ... resumes, also known as skills resumes, emphasize your skills, strengths, and accomplishments Advantages: A popular choice for recent college graduates and career switchers; provides a practical format...

Ngày tải lên: 25/10/2013, 16:20

... ronsternimages.com, A5 design, onepartart.com Design 153 Homepage design Second-level template for less content Please purchase PDF Split-Merge on www.verypdf.com to remove this watermark 605 606 Chapter ... Photography, A5 design Design 162 Homepage design Please purchase PDF Split-Merge on www.verypdf.com to remove this watermark 591 592 Chapter 20 ■ Templates Included on DVD Second-level template for ... Photography Please purchase PDF Split-Merge on www.verypdf.com to remove this watermark 587 588 Chapter 20 ■ Templates Included on DVD Design 164 Homepage design Second-level template for less...

Ngày tải lên: 24/12/2013, 15:16

... idlerphotography.com Design 134 Homepage design Please purchase PDF Split-Merge on www.verypdf.com to remove this watermark 633 634 Chapter 20 ■ Templates Included on DVD Second-level template for less ... Please purchase PDF Split-Merge on www.verypdf.com to remove this watermark 637 638 Chapter 20 ■ Templates Included on DVD Design 131 Homepage design Second-level template for less content Please ... idlerphotography.com Please purchase PDF Split-Merge on www.verypdf.com to remove this watermark 645 646 Chapter 20 ■ Templates Included on DVD Design 126 Homepage design Second-level template for less...

Ngày tải lên: 24/12/2013, 15:16