... total number of nodes increases, the achievable throughput can exhibit an up-anddown behavior reaching a a maximum at a critical spatial node density that is proportional to a power of the ratio ... achievable with high probability CONCLUSION This paper examined the uniform throughput of large ad hoc networks confined to a region of fixed area It was found that, for a large enough total area, as ... covariance matrix of the quantities CT,ii for i = 1, 2, , n Due to uniformity of the nodes distribution, all diagonal elements of M are equal and all offdiagonal elements of M are also equal...
Ngày tải lên: 22/06/2014, 00:20
... Masur H, Gerlach H, Calandra T, Cohen J, Gea-Banacloche J, Keh D, Marshall JC, Parker MM, et al.: Surviving sepsis campaign guidelines for management of severe sepsis and septic shock Crit Care ... Critical Care Vol 10 No Saxena and Andrews Friedrich JO, Adhikari NKJ, Meade MO: Drotrecogin alfa (activated): does current evidence support treatment for any patients with severe sepsis? Crit Care ... 10:145 Warren HS, Suffredini AF, Eichacker PQ, Munford RS: Risks and benefits of activated protein C treatment for severe sepsis N Engl J Med 2002, 347:1027-1030 Siegel JP: Assessing the use of activated...
Ngày tải lên: 13/08/2014, 03:20
Limited resource visualization with region of interest
... simple approach which gives snapshots of time-varying data at sequential time step This approach may not handle very large data-sets Feature tracking is an efficient approach to extract and track region- of- interest ... visualization is a more general term that handles data beyond science and also includes data analysis techniques The power of visualization has made it widely applied in many domain of applications as follows ... Generally, geographic information is represented by two approaches: layer-based and featurebased Layer-based approach models spatial data by a set of layers containing independent information,...
Ngày tải lên: 15/09/2015, 17:10
Báo cáo khoa học: The N-terminal region of the bacterial DNA polymerase PolC features a pair of domains, both distantly related to domain V of the DNA polymerase III s subunit ppt
... 20 Abe Y, Jo T, Matsuda Y, Matsunaga C, Katayama T & Ueda T (2007) Structure and function of DnaA N-terminal domains: specific sites and mechanisms in inter-DnaA interaction and in DnaB helicase ... DnaE OB domain [12,16] The very N-terminal region of PolC and the C-terminal domain of DnaE appear to be specific for each type of polymerase The small a ⁄ b C-terminal domain of DnaE has been shown ... protein alignments with assessment of statistical significance J Mol Biol 326, 317–336 24 Natrajan G, Noirot-Gros MF, Zawilak-Pawlik A, Kapp U & Terradot L (2009) The structure of a DnaA ⁄ HobA complex...
Ngày tải lên: 05/03/2014, 23:20
Interest Rate Options - A discussion of how investors can help control interest rate exposure and make the most of the interest rate market pdf
... must fall when interest rates rise, consider a Treasury bond held by an investor with a principal or par amount of $1,000, payable at maturity, and a coupon interest rate of 7% This means that the ... rates The calculation is complex, but can be performed using many analytical software packages, vendor systems and most modern financial calculators If you are unable to calculate duration, consult ... about interest rate movements A call buyer anticipates interest rates will go up, increasing the value of the call position A put buyer anticipates that rates will go down, increasing the value of...
Ngày tải lên: 06/03/2014, 14:20
Forecasting UK GDP growth, inflation and interest rates under structural change: a comparison of models with time-varying parameters potx
... Time-varying parameters, stochastic volatility, VAR, FAVAR, forecasting, Bayesian estimation JEL classification: C32, E37, E47 (1) External MPC Unit Bank of England Email: alina.barnett@bankofengland.co.uk ... models that incorporate a gradual change in parameters and also include a large set of explanatory variables particularly well as far as the inflation forecast is concerned recording gains (over ... methodology Data Our main data set consists of quarterly annualised real GDP growth, quarterly annualised inflation and the three-month Treasury bill rate Quarterly data on these variables is available...
Ngày tải lên: 06/03/2014, 14:20
Báo cáo khoa học: Functional analysis of a murine monoclonal antibody against the repetitive region of the fibronectin-binding adhesins fibronectin-binding protein A and fibronectin-binding protein B from Staphylococcus aureus pot
... FITC was measured in the FL1 channel (510–535 nm bandpass filter) Data were recorded and analyzed with flowmax software from Partec Statistical analysis of ELISA experiments Each experiment was repeated ... Monoclonal antibodies against FnBRs of FnBPB A panel of mouse mAbs was produced against the recombinant repetitive region of FnBPB Analysis of mAbs binding to the recombinant FnBR indicated the ... aureus, one of the most important Gram-positive pathogens of humans and animals, is a highly versatile bacterium capable of causing a wide spectrum of diseases, ranging from superficial skin infections...
Ngày tải lên: 06/03/2014, 22:21
Báo cáo Y học: Subsite mapping of the binding region of a-amylases with a computer program ppt
... subsite maps of rice and barley a- amylases are thus also presented MATERIALS AND METHODS SUMA software: subsite mapping of amylases This software calculates the apparent binding energies on the basis ... has been evaluated for PPA, an a- amylase studied by us earlier Also an attempt has been made to use this program for subsite mapping of other a- amylases found in the literature Evaluations of ... measured earlier SUMA is freely available for research and educational purposes (E-mail: gyemant@tigris.klte.hu) Action patterns of a- amylases Action patterns are summarized in the tables below: Table...
Ngày tải lên: 08/03/2014, 09:20
Báo cáo khoa học: A region within the C-terminal domain of Ure2p is shown to interact with the molecular chaperone Ssa1p by the use of cross-linkers and mass spectrometry doc
... An alternative explanation that can account for this observation is that Ssa1p binds with higher affinity a conformational state of Ure2p as a result of the presence of the N-terminal domain of ... blotted and stained with antibodies directed against Ure2p or His-Tagged Ssa1p (B) (A) A mixture of untreated Ure2p and Ssa1p (lane 1); Ure2p alone (lanes 2, 5, and 11), Ssa1p alone (lanes 3, 6, and ... monomeric Ssa1p and Ure2p–Ssa1p complexes with apparent molecular masses of 120 and 160 kDa were excised Each protein band was subjected to in-gel enzymatic cleavage after reduction and alkylation of...
Ngày tải lên: 15/03/2014, 00:20
Báo cáo khoa học: Probing the unfolding region of ribonuclease A by site-directed mutagenesis potx
... CGG AAT GCC ACC AAA GAT CGA TGC AAG C-3Â rev 5Â-G CTT GCA TCG ATC TTT GGT GGC ATT CCG GCT CTT CAT CAT C-3Â fw 5Â-G ATG ATG AAG AGC CGG AAT TCC ACC AAA GAT CGA TGC AAG C-3Â rev 5Â-G CTT GCA TCG ATC ... 6-FAM-dArU(dA)2-6-TAMRA as substrate [23], revealed that all RNase A variants are active (Table 3) However, while the RNase A variants with mutations in the Ala20 loop region as well as N34DRNase A and L3 5A- RNase ... TCC AGC ACT TCC GCC GCC CTG AGC TCC AAC TAC TG3Â rev 5Â-CA GTA GTT GGA GCT CAG GGC GGC GGA AGT GCT GGA G-3Â fw 5Â-C CAG ATG ATG AAG AGC CGG GAC CTG ACC AAA GAT CGA TGC-3Â rev 5Â-GCA TCG ATC TTT...
Ngày tải lên: 16/03/2014, 18:20
Báo cáo khoa học: A chloroplast RNA binding protein from stromal thylakoid membranes specifically binds to the 5¢ untranslated region of the psbA mRNA potx
... +24 relative to the AUG): T7-psbB5¢ (5¢-GTAATACGACTCACTATAGGGTAAATTAATT TAATTTAAAATC-3¢) and psbB3¢ (5¢-TACACGATA CCAAGGTAAACC-3¢) Each template contained the promotor of the T7 RNA polymerase fused ... (5¢-GATCCATGGTCATATGTTAATTTTTTTAA AG-3¢); )36-RNA (wild-type sequence of the psbA mRNA corresponding to positions )36 to +13 relative to the AUG); T7–36ntA5¢ (5¢-GTAATACGACTCACTATAGG GTTTACGGAGAAATTAAAAC-3¢) and ... psbA RNA (wild-type sequence of the psbA mRNA corresponding to positions )91 to +13 relative to the AUG); T7-psbA5¢ (5¢-GTAATACGACTCA CTATAGGGTACCATGCTTTTAATAGAAG-3¢) and 2054 (5¢-GATCCATGGTCATATGTTAATTTTTTTAA...
Ngày tải lên: 17/03/2014, 11:20
Báo cáo Y học: The human b-globin locus control region A center of attraction potx
... proteins and binds to DNA as a heterodimer usually composed of USF1 and USF2 USF has been implicated in the regulation of many genes and normally acts as a transcriptional activator However, it has also ... absence of chromatin assembly Mol Cell Biol 21, 2629–2640 86 Ogawa, K., Sun, J., Taketani, S., Nakajima, O., Nishitani, C., Sassa, S., Hayashi, N., Yamamoto, M., Shibahara, S., Fujita, H & Igarashi, ... Hohmura, K.I., Bungert, J., Hayashi, N., Nagasawa, T., Engel, J.D., Yamamoto, M., Takeyasu, K & Igarashi, K (1999) Long range interaction of cis-DNA elements mediated by architectural transcription...
Ngày tải lên: 18/03/2014, 01:20
NEWS AND INTEREST RATE EXPECTATIONS: A STUDY OF SIX CENTRAL BANKS pot
... an interest rate decision, as discussed in the main text Table A1 : Interest Rate Data and Sources 90-day futures (a) Australia Cash rate: Reserve Bank of Australia Bulletin Table A. 2 Canada Bankers ... viewed as good or bad While Chadha and Nolan characterise higher variance as bad, Kohn and Sack assume that increased variance is evidence that central bank communication conveys important information ... Bankers acceptances: Target rate: Bank of Canada BA1–BA8 Euro area EurIBOR: ER1–ER8 Repo rate: European Central Bank NZ Bank bills: ZB1–ZB8 Cash rate: Reserve Bank of New Zealand UK LIBOR: L1–L8 Base...
Ngày tải lên: 22/03/2014, 23:20
Báo cáo khoa học: The )148 to )124 region of c-jun interacts with a positive regulatory factor in rat liver and enhances transcription Dipali Sharma*, Sujata Ohri and Aparna Dixit ppt
... reaction mixture was placed on ice and UV irradiated (254 nm) for 15 [25] Following irradiation, the mixture was separated by SDS/PAGE (15% acrylamide) and analysed by autoradiography changes of ... over a period of 30 and autoradiographed Affinity purification of the factor(s) interacting with the )148 to )124 region of c-jun This was carried out essentially as described by Kadonaga and Tjian ... to the region )148 to )124 of c-jun and stimulates transcription Materials and methods Reagents and animals All chemicals were of reagent grade and were from Sigma Chemical Co unless stated otherwise...
Ngày tải lên: 23/03/2014, 20:22
Báo cáo khoa học: Identification of the N-terminal region of TjZNT2, a Zrt⁄Irt-like protein family metal transporter, as a novel functional region involved in metal ion selectivity ppt
... -MASSPTKILCDAGESDLCRDDAAAFLLKFVAIASIL 1:MFFIDVLWKLFPLYLFGSERDYLSETESILKIVPETMAAASSLSILCDAGEPDLCRDDSAAFLLKLVAIASIF TjZNT1 TjZNT2 37:LAGVAGVAIPLIGKNRRFLQTEGNLFVAAKAFAAGVILATGFVHMLAGGTEALTNPCLPDYPWSKFPFPGFFA ... using Thlaspi caerulescens as a model system Ann Bot 102, 3–13 Weber M, Harada E, Vess C, Roepenack-Lahaye E & Clemens S (2004) Comparative microarray analysis of Arabidopsis thaliana and Arabidopsis ... (2007) Transition ¨ metal transport FEBS Lett 581, 2263–2272 N-terminus of TjZNT2 is involved in ion selectivity Tomatsu H, Takano J, Takahashi H, Watanabe-Takahashi A, Shibagaki N & Fujiwara T (2007)...
Ngày tải lên: 29/03/2014, 00:20
Fixed Deposit Accounts: Accounts that give you a fixed rate of interest for a defined term. potx
... Gross Rate is the daily interest accrual rate AER (Annual Equivalent Rate) illustrates what the interest would be if interest was paid and compounded each year Our Annual Equivalent Rate (AER) calculation ... sites Annual Equivalent Rate (AER) illustrates what the interest would be if interest was paid and compounded each year Our AER calculation assumes that the account is held for a year and that the ... was paid and compounded each year Our AER calculation assumes that the account is held for a year and that the interest rate remains constant Deposit Interest Retention Tax (DIRT) - Accounts are...
Ngày tải lên: 29/03/2014, 01:20
Báo cáo khoa học: The C-terminal region of the proprotein convertase 1⁄ 3 (PC1⁄ 3) exerts a bimodal regulation of the enzyme activity in vitro pdf
... polypeptide was characterized by western blotting, amino acid analysis and N-terminal Edman sequencing (data not shown) MS analysis showed that the isolated CT-peptide had a molecular mass within Da of ... of PC1 ⁄ and binds the active site with nm affinity in vitro resulting in the formation of a stable proregion–enzyme complex [5] Additional cleavage of the proregion at Arg51-Ser-Arg-Arg54 leads ... enzymatic activity of PC1 ⁄ has also been ascribed to a potential endogenous inhibitor, proSAAS [3] Enzymatically active PC1 ⁄ is generated via a series of irreversible proteolytic cleavages of...
Ngày tải lên: 30/03/2014, 08:20
CONFLICTS OF INTEREST IN THE HOLLYWOOD FILM INDUSTRY: COMING TO AMERICA - TALES FROM THE CASTING COUCH, GROSS AND NET, IN A RISKY BUSINESS pdf
... Kroo|zrrg lv d qhw0surwv frqwudfw/ lq zklfk qhw surwv lv d frqwudfwxdoo| ghqhg whup/ qrw surw dv fdofxodwhg dffruglqj wr Jhqhu0 doo| Dffhswhg Dffrxqwlqj Sulqflsohv +JDDS,1 Vhyhudo glvsxwhv kdyh dulvhq ... ryhukhdg fkdujhv/ dqg lwv vkduh ri qhw surwv1 Hdfk frvw frpsrqhqw kdv vrph pdujlq ri surw fdofxodwhg lqwr lw1 Wkh vwxglr kdv d srwhqwldo frq lfw ri lqwhuhvw ehfdxvh lw pxvw eh wuxvwhg wr shuirup ... wkh qhjdwlyh frvw1 Wkh euhdn0hyhq srlqw ri wzlfh wkh qhjdwlyh frvw zdv fkrvhq ehfdxvh lw zdv fdofxodwhg wr eh wkh srlqw dw zklfk wkh vwxglr zrxog uhfryhu lwv glvwulexwlrq dqg dgyhuwlvlqj h{shqvhv...
Ngày tải lên: 30/03/2014, 12:21
Báo cáo khoa học: Characterization of the 5¢ untranslated region of a and b isoforms of the human thromboxane A2 receptor (TP) Differential promoter utilization by the TP isoforms doc
... rates [29], stimulation of apoptosis of immature thymocytes [30] TXA2 has been implicated as a mediator of a number of vascular disorders including thrombosis, unstable angina, myocardial infarction, ... Kinase reporter vectors and Dual LuciferaseÒ Reporter Assay System were obtained from Promega Corporation, Madison, WI, USA Taq DNA polymerase, T4 DNA ligase and calf intestinal alkaline phosphatase ... substantial variations in the relative levels of expression of TPa and TPb mRNAs in a variety of human tissues; whereas TPa mRNA levels remains constant between cell types, the levels of TPb vary...
Ngày tải lên: 31/03/2014, 09:20