... accuracy of Spade is 49% on the RST-DT corpus To obtain a clausal path, we map each anchor A i to its clause in Spade If anchors A i and A j belong to the same clause, we assign them the relation ... i and A j 5.3 Evaluation of templates At this stage, we have a set of accepted integral relation paths between any anchor pair A i and A j The next task is to merge appropriate set of anchors ... first stage, we evaluate from training data the relevance of relation path Path l = [A i , Rel ,…, Rel n , A j ] between candidate anchors A i and A j of types C i and C j We divide this task into...
Ngày tải lên: 23/03/2014, 18:20
... messages between databases can be calculated as follows databases (VLR and HLR) are shown in Table and are calculated from the values in Tables and The authentication delay for the proposed protocol ... load The transaction messages between mobile databases (VLR and HLR) are shown in Table which are calculated from the values in Tables and From the above equations and calculations, it has been ... this paper, the UMTS authentication and key agreement protocol and the signalling traffic that are generated by registration, call termination, and call origination have been investigated and analyzed...
Ngày tải lên: 22/06/2014, 22:20
Báo cáo y học: "Martial arts as a mental health intervention for children? Evidence from the ECLS-K" doc
... participation in martial arts as opposed to stable participation over years Association of martial arts with change in behavior Tables and present the means and standard deviations for behavior at each ... estimate standard errors There was a Participation in martial arts What fractions of students in our two samples participated in martial arts? For the kindergarten through 3rd grade sample, the ... Unweighted White, not Hispanic Black Hispanic, race specified Hispanic, race not specified Asian Hawaiian or Pacific Islander American Indian or Alaska native More than one race 66.8% 11.5% 7.5% 8.1%...
Ngày tải lên: 13/08/2014, 18:21
A prioritized MAC protocol for multihop, event driven wireless sensor network
... designed and tested ER-MAC on low node’s density (100 nodes over a 1000m*1000m area), ER-MAC may have problem on large scale network 2.3.5 Traffic-Adaptive MAC Protocol (TRAMA) TRAMA [7] is a TDMA-based ... in a forest for fire detection Sensors are attached to taxi cabs in a large metropolitan area to study the traffic conditions and plan routes effectively Clearly, there is a wide range of applications ... route-through traffic is more important than the originated traffic However, existing MAC protocols treat all packets indifferently, that may lead to the degradation in delay performance and quality of...
Ngày tải lên: 26/09/2015, 09:47
A User Identity Management Protocol for Cloud Computing Paradigm
... applications quickly and to scale up applications as much as when needed The platform supports traditional Java™ and Linux, Apache, MySQL, PHP (LAMP) stack-based applications as well as new architectures ... system, and a natural evolution for data centers that employ automated systems management, workload balancing, and virtualization technologies A cloud infrastructure can be a cost efficient model for ... Unavailability of a web site may hinder the on-going transactions and it may lead to loss of money and customers Technologies such as load balancing hardware and software are aimed at ensuring availability...
Ngày tải lên: 31/07/2013, 09:43
A study on communicative activities in english reading classes for the 10th from students
... liner (ship) A kind of film that makes you laugh It is a famous cartoon film and the main characters are a mouse and a cat A famous person/ actor/ actress in a film Suggested answers: Cartoon Director ... activities are available, however, how and in what way to apply those activities in real teaching and learning English is still a question for many teachers The teaching practice at Thach Thanh II ... Results from Teachers 0 0 Most of teachers have been teaching English for 1-2 years, only one teacher has taught English for years This has both advantages and disadvantages in their teaching Because...
Ngày tải lên: 18/12/2013, 10:03
Fault tree synthesis from a directed graph model for a power distribution network
... boundary and the boundary variables are treated as P0 / -S primal events The unit models describe both normal and failed behavior and depend on a wide variety of operating parameters and failure ... i.e changes from the normal, steady-state value The output variable is the variable of immediate concern, here V2 Changes in the output variable are caused by changes in the input variable, VI ... the causal relationships between variables including normal and failed states The basic elements of a digraph are shown in figure for conduction in a wire Node labels represent deviation variables,...
Ngày tải lên: 03/01/2014, 19:37
Tài liệu The Cost of a Military Person-Year - A Method for Computing Savings from Force Reductions pptx
... compensation (RMC) RMC includes average basic pay for each military grade, basic allowance for housing, basic allowance for subsistence, and federal tax advantage accruing to the aforementioned allowances ... of Program Analysis and Evaluation (PA&E) NOTE: Data are budget estimates, not execution data avoided by this action If a similar calculus can then be performed for an alternative civilian position, ... current military personnel Instead, DoD pays an annual accrual charge into the trust funds These accrual charges are carefully calculated actuarial payments that represent the best estimates of the...
Ngày tải lên: 17/02/2014, 23:20
Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc
... thermophilus E coli A pernix 277 277 283 TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... (Osaka, Japan) Emulgen 911 was a gift from Kao Chemical (Tokyo, Japan) NADPH, NADH and NADP+ were purchased from Oriental Yeast (Tokyo, Japan) a- Cyano-4-hydroxycinnamic acid was obtained from ... CYP17 5A1 The numbers in parentheses indicate the Tm value of each protein at neutral pH aData from this study bData from Griffin et al [32] cData from Yano et al [4] solution was stirred at °C for...
Ngày tải lên: 18/02/2014, 08:20
Tài liệu Báo cáo khoa học: "A Pattern Matching Method for Finding Noun and Proper Noun Translations from Noisy Parallel Corpora" doc
... m a n judges (El-E3) Evaluator E1 is a native Cantonese speaker, E2 a Mandarin speaker, and E3 a speaker of both languages The results are shown in Figure The average accuracy for all evaluators ... N candidate evaluation is useful because in a machine-aided translation system, we could propose a list of up to, say, ten candidate translations to help the translator We obtained the evaluations ... technique, was proposed as a good way to match these 1This was found to be the case in the Japanese translation of the AWK manual (Church et al 1993) The Japanese AWK was also found to contain different...
Ngày tải lên: 20/02/2014, 22:20
The impact of a cancer Survivorship Care Plan on gynecological cancer patient and health car provider reported outcomes (ROGY Care): study protocol for a pragmatic cluster randomized controlled trial potx
... socioeconomic variables such as age, education, marital status, and employment status, and clinical variables such as cancer stage at diagnosis, time after diagnosis, and initial treatment All measures ... usual care group with that of the SCP approach by giving a patient randomized to usual care more information than was intended for usual care Also, if usual care patients learn from other patients ... different areas of the disease, diagnosis, treatment and care, and some qualitative aspects, for instance wishes for more information The questionnaire contains the following scales: (a) Information about...
Ngày tải lên: 05/03/2014, 15:20
Báo cáo khoa học: A DmpA-homologous protein from Pseudomonas sp. is a dipeptidase specific for b-alanyl dipeptides Hidenobu Komeda and Yasuhisa Asano docx
... D-Ala-Gly, D-Ala-(Gly)2 (D-Ala)2, D-Ala-L-Ala (D-Ala)3 (D-Ala)4, L-Ala-Gly, L-Ala-(Gly)2 (L-Ala)2, L-Ala-D-Ala, L-Ala-D-Ala-L-Ala, DL-Ala-DL-Asn, DL-Ala-DL-Ile, DL-Ala-DL-Leu, DL-Ala-DL-Met, DL-AlaDL-Phe, ... L-Ala-pNA D-Ala-NH2 L-Ala-NH2 D-Ala-(Gly)2 L-Ala-(Gly)2 b-Ala-L-Ala b-Ala-Gly b-Ala-NH2 b-Ala-L-His (Carnosine) b-Ala-L-Leu (b-Ala)2 similarity to that from dmpA of O anthropi LMG7991 DmpA has ... (BapA) acting on d-Ala-pNA was purified and characterized BapA was found to show a unique substrate specificity for b-alanyl dipeptides H Komeda and Y Asano Results Characterization of the flanking...
Ngày tải lên: 07/03/2014, 21:20
Thumbnailing for Animation Thumbnails from a sequence of Disney’s Rescuers pdf
... www.animationmeat.com Preparing for Animation: The Art of Thumbnailing The Art of Thumbnailing PDF produced by www.animationmeat.com Preparing for Animation: The Art of Thumbnailing The Art of ... www.animationmeat.com Preparing for Animation: The Art of Thumbnailing 11 The Art of Thumbnailing PDF produced by www.animationmeat.com Preparing for Animation: The Art of Thumbnailing 12 The Art ... www.animationmeat.com Preparing for Animation: The Art of Thumbnailing 18 The Art of Thumbnailing PDF produced by www.animationmeat.com Preparing for Animation: The Art of Thumbnailing 19 The Art...
Ngày tải lên: 08/03/2014, 11:20
A Roadmap for US Robotics From Internet to Robotics docx
... automatically extracting salient behaviors from multi-modal data should enable for data segmentation and analysis, for aiding quantitative diagnosis • In 15 years, we can accomplish connecting and ... the way that manufacturing was revolutionized by automation several decades ago Haptic devices, a form of robotics, are already used for simulations to train medical personnel 24 A Roadmap for ... Health Data Acquisition We are approaching an age of nearly pervasive perception Cameras are cheap, and getting cheaper, and image analysis algorithms are getting better The networking infrastructure...
Ngày tải lên: 15/03/2014, 21:20
Báo cáo khoa học: Characterization of a membrane-bound aminopeptidase purified from Acyrthosiphon pisum midgut cells A major binding site for toxic mannose lectins pptx
... APN3 AAX39865 Tni APN3 AAN75694 Har APN2 AAF37560 Hpu APN3 AAF99701 Epo AAD31183 Ldi APN1 AAC36148 Pin AAK58066 Hvi AAL83943 Bmo APN3 AAF37559 Hpu APN2 AAB70755 Pxy AAK69605 Sli AAF08254 Hvi AAX39866 ... Tni APN4 AAN75693 Har APN1 AAF37558 Hpu APN1 BAA33715 Bmo Family Family AAX39863 Tni APN1 AAC33301 Bmo Q11001 Mse CAA10950 Pxy P91885 Mse APN2 BAA32140 Bmo 0.1 AAD31184 Ldi APN2 A pisum APN CAA66467 ... substrate concentrations SEM values were calculated by fitting data by a weighted linear regression using the software SigmaPlotÒ AlabNA, L-alanine-b-naphthylamide; AlapNA, L-alanine-p-nitroanilide;...
Ngày tải lên: 16/03/2014, 12:20
Spline Methods for Extracting Interest Rate Curves from Coupon Bond Prices docx
... taxes or transaction costs, absence of arbitrage implies that the price of any coupon bond can be computed from an interest rate curve In particular, if the principal and interest payment of a ... II,” Numerische Mathematik, 16 (1971), 451-54 Wahba, G Spline Models for Observational Data, SIAM, Philadelphia ,1990 Waggoner, D “The Robustness of Yield and Forward Rate Extraction Methods,” ... values of this integral indicate a smoother forward rate curve The results are presented in Tables 2a and 2b From these tables, we see that Fisher varies over a much wider range than 10 either McCulloch...
Ngày tải lên: 22/03/2014, 17:20
Which interest rate scenario is the worst one for a bank? Evidence from a tracking bank approach for German savings and cooperative banks potx
... empirical analysis using a large German panel data set Fred Ramb 26 22 2007 Volatile multinationals? Evidence from the labor demand of German firms Claudia M Buch Alexander Lipponer 23 2007 International ... 34 2007 Factor-MIDAS for now- and forecasting with ragged-edge data: a model comparison for German GDP Massimiliano Marcellino Christian Schumacher 35 2007 Monetary policy and core inflation Michele ... quality of banking and regional growth Hasan, Koetter, Wedow 11 2007 Welfare effects of financial integration Fecht, Grüner, Hartmann 12 2007 The marketability of bank assets and managerial Falko...
Ngày tải lên: 22/03/2014, 23:20