... [22] In the traumatically injured brain, however, the synthesis of MT1 and MT2, as well as the synthesis of GIF, are up-regulated by reactive astrocytes in the vicinity of the lesion [ 23] This ... (1997) Disruption of the metallothionein- FEBS Journal 277 (2010) 2 931 –2 939 ª 2010 The Authors Journal compilation ª 2010 FEBS C Howells et al 29 30 31 32 33 III gene in mice: analysis of brain zinc, ... partly explaining the vast neuronal loss in the AD brain Further investigation of the increased neurotrophic activity of the AD brain revealed that it correlated with the loss of a specific neuroinhibitory...
Ngày tải lên: 16/02/2014, 15:20
... PKC substrate, 80K/MARCKS, 36 4 G Wein et al (Eur J Biochem 270) 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 increases sharply when Swiss 3T3 cells move out of cycle and enter G0 Proc ... orientation 35 6 G Wein et al (Eur J Biochem 270) Ó FEBS 20 03 Fig Formation of two major complexes between Swiss 3T3 proteins and the 3 -UTR of the MARCKS mRNA (A) The MARCKS 3 -UTR, the stop codon UAA of ... (complete 3 -UTR of MARCKS); pDK2: 131 0– 230 9 bp; pDK8: 131 0–1562 bp The poly(A) signal of the bovine growth hormone was provided by the pcDNA3 vector (B) Luciferase activity of transfected Swiss 3T3...
Ngày tải lên: 08/03/2014, 08:20
Đề tài " (log t)2/3 law of the two dimensional asymmetric simple exclusion process " pdf
... Under the assumptions (3. 9) (3. 10), the term on the right side of (4.28) is much smaller than the accuracy we need for Theorem 3. 1 Therefore this condition will be imposed for the rest of the paper ... requirements of the fine details of the dynamics and the initial data Furthermore, it is not clear whether the analysis on the current across the origin can be extended to the diffusivity In particular, the ... κn = 2 /3 − (−1)n 2−2N +n+1 /3, n = 1, · · · , 2N Explicit examples are κ2N = 2 /3 − 2 /3 = 0, κ2N −1 = 2 /3 + 1 /3 = 1, κ2N 3 = 2 /3 + 1/12, κ2N −2 = 2 /3 − 1/6, · · · , κ2 = 2 /3 − 2−2N +3 /3 With...
Ngày tải lên: 22/03/2014, 16:20
Governance and organizational structure of the inter-agency secretariat to the United Nations International Strategy for Disaster Risk Reduction (ISDR) pot
... component B of the humanitarian affairs programme of work, better reflecting the relationship of this work to the other components of the programme OIOS is also of the view that the ISDR secretariat ... that the disaster risk reduction activities of the Organization are adequately reflected in the programme of work of the Organization in the overall humanitarian assistance components of the biennial ... 19 The organizational arrangements for the previous secretariat of the IDNDR were reflected in the Secretary-General’s Bulletin (SGB) issued in 1999 on the organization of the Office for the...
Ngày tải lên: 23/03/2014, 02:20
univ of minnesota press mechademia 3 limits of the human nov 2008
Ngày tải lên: 11/06/2014, 15:46
Báo cáo khoa học: "Germination behaviour of 3 species of the genus Pinus in relation to high temperatures suffered during forest fires" pdf
... seed of P pinaster and P radiata coincides with the spring and lasts during the whole of end of (Vega, 1977) However, the availability of the seed for germination is not the same in all the species, ... the characteristics of a site may play an important role in determining the survival of the seedlings (Moreno and Oechel, 1992) To discover the adaptive advantages in the event of a fire of the ... (Fenner, 19 83) The small sizes of seed facilitate dissemination over long distances, while the storage of considerable reserves in the large seeds favours the subsequent establishment of the seedlings...
Ngày tải lên: 08/08/2014, 19:21
TOPIC 3 FORMS OF THE VERBS
... them 33 We began (talk)…………………………… about next year’s holiday two months ago 34 I remember (lock)………… the door when I left but forgot (shut) ………… the window 35 He agrees (start)…………………………… the ... yet? 30 We decided (rent)……………………… a house with a swimming pool 31 Can you help me (get) …………………… the dinner ready? 32 When we arrived, the people next door invited us (have)……………a drink with them ... possible 36 I finished (read)………………………… the book and went to bed 37 My teachers always expected me (do)………………………………… well in exams 38 Let me (pay) ………………………………… for the meal You paid last time 39 I...
Ngày tải lên: 25/08/2016, 00:53
Microreaction technology industrial prospects IMRET 3 proceedings of the third international conference on microreaction technology
... Springer, 2000 ISBN- 13: 978 -3- 642-64104-6 e-ISBN- 13: 978 -3- 642-59 738 -1 DOl: 10.1007/978 -3- 642-59 738 -1 This work is subject to copyright All rights are reserved, whether the whole or part of the material ... thickness of 30 0 !-1m The foils are stacked upon each other using separation foils A 90°-angle 23 of the structured foils with respect to each other forms a cross-flow heat exchanger The number of layers ... 72 ,34 6 Menz, W 506 Mex, L 402 Meyer, T 38 3 Meyer, W 31 2 Morgan, D.O 235 Muller, J 402 Muller, M 38 3 Neumann, M 420 Niggemann, M 1 13 Nilsson, J 32 0, 430 ...
Ngày tải lên: 15/02/2017, 16:01
THE structure of the multiprogramming system
... in their homing position Each process blocked in the course of task execution relies on the other processes for removal of the barrier Essentially, the proof in question is a demonstration of the ... they are called the P-operation and the V-operation A process, "Q" say, that performs the operation " P (sem)" decreases the value of the semaphore called "sem" by If the resulting value of the ... the value of the semaphore called "sem" by If the resulting value of the semaphore concerned is positive, the V-operation in question has no further effect; if, however, the resulting value of...
Ngày tải lên: 12/09/2012, 15:05
Tài liệu Báo cáo khoa học: Crystal structure of the cambialistic superoxide dismutase from Aeropyrum pernix K1 – insights into the enzyme mechanism and stability pdf
... 50.0–1.48 (1. 53 1.48) 1.92 7.7 (38 .3) 95.9 (88.9) 732 659 124 631 6.1 (5.2) 16.6 (3. 6) 18 .3 36. 13 1.57 (1.61–1.57) 98 731 (6589) 19.8 (33 .7) ⁄ 23. 6 (35 .9) 0.008 1. 135 6984 29 630 31 .86–1 .35 (1 .38 –1 .35 ) 152991 ... comparisons with 28 29 30 31 32 33 34 35 36 37 38 39 the manganese enzyme from Thermus thermophilus Biochemistry 34 , 1646–1660 Whittaker MM & Whittaker JW (1996) Low-temperature thermochromism marks ... NE2 of His31, bound to the metal, in the company of a water oxygen, from the apical positions The manga˚ nese was only 0.06 A out of the equatorial plane (Table 3) The angles around the metal cofactor...
Ngày tải lên: 14/02/2014, 22:20
Tài liệu Inequalities in Higher Education and the Structure of the Labour Market pdf
Ngày tải lên: 15/02/2014, 17:20
Tài liệu High-level Expert Group on reforming the structure of the EU banking sector docx
... the EU reaching € 43 trillion by 2008 ( 32 trillion in the euro area), or about 35 0% of EU GDP (chart 2 .3. 1) With the onset of the crisis, there has been a slowdown in the relative growth of the ... BG 31 25.8 74.2 39 23. 5 76.5 CZ 38 13. 2 86.8 168 5.1 94.9 CY 39 15.4 84.6 125 68.4 31 .6 DE 1, 737 95 .3 4.7 7,996 94.8 5.2 DK 1 13 95.6 4.4 920 87.7 12 .3 EE 18 22.2 77.8 20 5.7 94 .3 ES 230 44 .3 55.7 ... 2.1 2.2 2 .3 2.4 2.5 DIVERSITY OF BANK BUSINESS MODELS IN EUROPE 32 3. 1 3. 2 3. 3 3. 4 3. 5 3. 6 INTRODUCTION 32 GENERAL FINDINGS ON THE PERFORMANCE AND RISKS OF DIFFERENT...
Ngày tải lên: 16/02/2014, 10:20
Tài liệu Báo cáo khoa học: Structure of the putative 32 kDa myrosinase-binding protein from Arabidopsis (At3g16450.1) determined by SAIL-NMR docx
... MBPfromB.napus194 -33 6 MBPfromB.napus356-498 At1g52 030 .2-154 At1g52 030 .161-289 At1g52 030 .33 6-476 At3g16400.2-142 At3g16440.2-144 At3g16440.154 -30 0 At3g16470.2-145 At3g16470.158-297 At3g16470 .30 8-450 At3g2 138 0.7- 130 ... analysis of At3g16450.1 with sugars Fig Three-dimensional NMR structure of At3g16450.1 (A) Superposition of the 20 energy-minimized conformers that represent the 3D solution structure of the N-terminal ... AQKVEAGGGAGGASWDDG-VHDGVRKVHVGQGQDGVSSINVVYAKDSQDVEGGEHGKKTL At3g16450.1C MBPfromB.napus1-125 MBPfromB.napus194 -33 6 MBPfromB.napus356-498 At1g52 030 .2-154 At1g52 030 .161-289 At3g16400.2-142 At3g16440.2-144 At3g16440.154 -30 0 At3g16470.2-145 At3g16470.158-297...
Ngày tải lên: 18/02/2014, 14:20
Tài liệu Báo cáo khoa học: Crystal structure of the catalytic domain of DESC1, a new member of the type II transmembrane serine proteinase family pptx
... surround the active site and are named according to the residue in the midpoint of the respective loop, as shown in Fig To the east of the active site the 37 - and 60-loops border the S2¢ pocket of the ... recognition of the variable part of the substrates (side chains) Examination of the individual subsites S3–S2¢ strongly suggests that at least the structurally solved members of the four subtypes of the ... nicely the interaction of the S1 site, but not interact with the S2 site of these proteinases By contrast, the aspartates in positions P2 and P3 of the chloromethylketone occupy the S2 and S3 ⁄...
Ngày tải lên: 19/02/2014, 00:20
Tài liệu Báo cáo khoa học: Crystal structure of the BcZBP, a zinc-binding protein from Bacillus cereus doc
... improving the sensitivity of progressive FEBS Journal 274 (2007) 30 44 30 54 ª 2007 The Authors Journal compilation ª 2007 FEBS 30 53 Crystal structure of BcZBP from B cereus 28 29 30 31 32 33 V E Fadouloglou ... be discussed later The structure of the active site, the type of protein ligands, the zinc-binding motif, the presence of a water FEBS Journal 274 (2007) 30 44 30 54 ª 2007 The Authors Journal ... rmsd of 1.0 A for the Ca atoms Thus, the movement of the a2 helix accounts for 23% of the rmsd value (i.e for approximately one quarter of the structural difference between the enzymes) These...
Ngày tải lên: 19/02/2014, 00:20
Tài liệu Báo cáo khoa học: Spectroscopic characterization of a higher plant heme oxygenase isoform-1 from Glycine max (soybean) ) coordination structure of the heme complex and catabolism of heme docx
... information on the heme pocket structure As shown in Table 2, the hyperfine splitting constants of the 15N nucleus of the distal NO and of the 14N nucleus of the proximal His of the GmHO-1 complex ... (1990) The effects of amino 539 8 23 24 25 26 27 28 29 30 31 32 33 acid substitution at position E7 (residue 64) on the kinetics of ligand binding to sperm whale myoglobin J Biol Chem 265, 31 68 31 76 ... unique structure of the opening of the heme pocket of GmHO-1 Such a structure might inhibit the approach of imidazole to the heme in GmHO-1, explaining the smallest Kimidazole value Mechanism of...
Ngày tải lên: 19/02/2014, 05:20
Tài liệu Báo cáo khoa học: Unusual metal specificity and structure of the group I ribozyme fromChlamydomonas reinhardtii23S rRNA pptx
... structure of Cr.LSU ribozyme T.-C Kuo et al attacks the 5Â splice site (G-dependent cleavage), generating 5Â exon and intron -3 exon intermediates Then, the 3 -OH of the 5Â exon attacks the 3 ... lacks the large P6 extension and the last three nucleotides (AU XG) of the intron The sizes of the intron (InDGb) and 5Â exon (5E) are indicated The arrow indicates cleavage of the pre-RNA at the ... most of P9.1 is neutral The 5Â strand of P9.0 is protected despite the absence of the 3 strand For the idiosyncratic P7.1 and P7.2 domains, the helices are weakly protected, except for the 3 ...
Ngày tải lên: 19/02/2014, 07:20