... specifically calls for a particular field mapped onto a particular geometry, the data for that mapping may not even explicitly reside in a database table That is, many physical or mechanical measures ... visualization tools and database systems can work very well to support both the actual FEA simulation workflow and data management and for the post-production data analysis tasks The tools have ... this report is about interactions between a user, a visualization environment, and a database We have to create a larger event loop to incorporate new input data from the database Here’s how...
Ngày tải lên: 30/03/2014, 22:20
... fall asleep our patient had to either lie on her hands or hold an object in her hands Personal and family history Our patient was attending the 7th grade in an academic secondary school and was ... ophthalmological evaluation was performed to rule out Wilson’s disease The results of cranial magnetic resonance imaging and an electroencephalogram were normal, as were results of a cerebrospinal ... both on a physical and on a social (interpersonal) level as she had been taught in therapy Secondly, identifying and relating her feelings to others Thirdly, learning and practicing a relaxation...
Ngày tải lên: 11/08/2014, 00:23
Báo cáo y học: " Evaluation of Lumbar Facet Joint Nerve Blocks in Managing Chronic Low Back Pain: A Randomized, Double-Blind, Controlled Trial with a 2-Year Follow-U"
... bupivacaine with or without Sarapin Group II = bupivacaine and steroids with or without Sarapin WC = Workers compensation MVA = Motor vehicle injury Analysis of Data Numbers Analyzed Data were analyzed ... C-fibres Acta Anaesthesiol Scand 1990; 34: 335-8 69 Pasqualucci A, Varrassi G, Braschi A, et al Epidural local anesthetic plus corticosteroid for the treatment of cervical brachial radicular pain: ... 20: 539-45 Schwarzer AC, Wang SC, Bogduk N, et al Prevalence and clinical features of lumbar zygapophysial joint pain: A study in an Australian population with chronic low back pain Ann Rheum Dis...
Ngày tải lên: 26/10/2012, 09:07
OReilly.Building.a.Web.2.0.Portal.with.ASP.NET.3.5.Jan.2008-BBL
... Data access layer Encapsulates database access and provides an interface that is database and data source independent It also provides object factories that create Entity classes out of database ... work with the database DatabaseHelper is a class used for performing common database operations DashboardDataContext is generated by LINQ to SQL and maps entities to database tables Data Model To ... that work with databases via DatabaseHelper and DatabaseContext On the web layer, Default.aspx is the entry point It uses DashboardFacade to perform operations such as adding a new tab or widget,...
Ngày tải lên: 15/11/2012, 14:24
Tài liệu Module 2: Updating Data in a Database doc
... M+0#!7&%'7)0-!)%!&079(.0!)+0!+%'0!7(308!.9* .A! >%5! f5! G#!)+0!6%%9,!'0#/8!.9* .A! M01!J0))*#3,8!,090.)!)+0!L()(1(,0!)(18!)+0#! ,090.)!0(.+!=%##0.)*%#!(#-!.9* .A! S0&*$;8!(#-!)+0#!.9* .A! GZ5! H%&!*#,)&/.)*%#,!%#!*'7%&)*#3!>0)4% &A" #.5'-18!&0$0&!)%!0?0&.*,0!^!%$!O(1! ... I&0
Ngày tải lên: 21/12/2013, 19:15
Tài liệu Báo cáo khoa học: Differentiation stage-dependent preferred uptake of basolateral (systemic) glutamine into Caco-2 cells results in its accumulation in proteins with a role in cell–cell interaction pptx
... ratio obtained at h (data not shown) At 30 the basolateral ⁄ apical uptake ratio was 9.1 ± 3.7 and 5.2 ± 0.3 for 5-dayand 15-day-differentiated cells, respectively At 24 h the basolateral ⁄ apical ... SCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQK EITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISK Q EYDESGPSIVHR KCF B ADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYP GQAPPGAYPGQAPPGAYHGAPGAYPGAPAPGVYPGPPSGPGAYPS SGQPSAPGAYPATGPYGAPAGPLIVPYNLPLPGGVVPR ... dose and route of supplementation Data from a meta-analysis suggested that glutamine supplementation in critically ill patients may be associated with a decrease in complications and mortality rate,...
Ngày tải lên: 20/02/2014, 01:20
Database Description with SDM: A Semantic Database Model pdf
... user of a large database is determining the information content of the database and locating in the schema the information of use to him An SDM schema for a database can serve as a readable description ... SIMPLE-PREDICATE + [MAPPING SCALAR-COMPARATOR [CONSTANT; MAPPING]; MAPPING SET-COMPARATOR [CONSTANT; CLASS-NAME; MAPPING + [ATTRIBUTE-NAME; MAPPING.ATTRIBUTE-NAME] SCALAR-COMPARATOR c [EQUAL-COMPARATOR; ... application environment semantics (2) A database model must support a relativist view of the meaning of a database, and allow the structure of a database to support alternative ways of looking at...
Ngày tải lên: 30/03/2014, 22:20
Báo cáo hóa học: " Vaccination with a plasmid DNA encoding HER-2/ neu together with low doses of GM-CSF and IL-2 in patients with metastatic breast carcinoma: a pilot clinical trial" pptx
... evidence that trastuzumab may synergize with specific T-cells [12], making a combinatorial approach with vaccination and trastuzumab an attractive clinical treatment modality pDNA immunization has several ... obsolete and vaccines alone successful against early and metastatic breast cancer This would facilitate the practical management of Her2 positive carcinomas, since trastuzumab based strategies are ... Results Patient characteristics and clinical observations Eight women with a mean age of 57.5 years were accrued in this study Patient characteristics are summarized in Table All patients had advanced...
Ngày tải lên: 18/06/2014, 16:20
báo cáo hóa học:" Percutaneous endoscopic lumbar discectomy: clinical and quality of life outcomes with a minimum 2 year follow-up" doc
... Visual Analogue Scale pre and postoperatively Visual Analogue Scale pre and postoperatively tages of this technique include less paraspinal musculature trauma and smaller wounds Bone removal is ... introduced at the safe triangle of Kambin, [2] the risk of nerve damage was low We did not have any neurological deficit in all the patients done under general anesthesia The advantage of general anesthesia ... DA: Endoscopic transforaminal lumbar discectomy and reconfiguration: A postero-lateral approach into the spinal canal Surg Neurol 1998, 49:588-98 Lew SM, Mehalic TF, Fagone KL: Transforaminal...
Ngày tải lên: 20/06/2014, 01:20
Báo cáo hóa học: " The product of the Herpes simplex virus 1 UL7 gene interacts with a mitochondrial protein, adenine nucleotide translocator 2" pot
... 5'-AGGGCGGGGGCATCGGGCACCGGGATGGCCGCCGCGACGGCCGACGATG AGAAGTTCCTATTCTCTAGAAAGTATAGGAACTTCGACAGCAAGCGAACCGGAAT-3' GAAGTTCCTATACTTTCTAGAGAATAGGAACTTCCGGAAATGTTGAATACTCA TACTCTTCCTTTTTC-3' The linear PCR-generated ... (5'gatttcgcgcaggtgatgag-3') for UL8; and 18S rRNA-f (5'-actcaacacgggaaacctca-3') and 18S rRNA-r (5'-aaccagacaaatcgctccac-3') for 18S rRNA Reactions were performed using SYBER Premix Ex Taq II (Takara) with ... Real-time PCR amplifications were performed with primers UL6-f (5'-aaattctgtgtcaccgcaacaac-3') and UL6-r (5'-gcccgaagcactgactcaa-3') for UL6; UL8-f (5'-cttgctggacgcagagcacta-3') and UL8-r (5'gatttcgcgcaggtgatgag-3')...
Ngày tải lên: 20/06/2014, 01:20
báo cáo hóa học:" Establishment of an animal model of a pasteurized bone graft, with a preliminary analysis of muscle coverage or FGF-2 administration to the graft" potx
... radiographical examination, the femurs with the graft were decalcified with EDTA (ethylenediaminetetraacetic acid), and cut sagittally, then stained with hematoxylin and eosin and tartrate-resistant ... formation (1) and bridging or lamellar bone formation (2) An assessment of these results was made and agreed upon by AS, TY and NT Tartrate-resistant acid phosphatase (TRAP) staining After radiographical ... the lateral view using Alpha Ease FC software (Alpha Innotech, San Leandro, CA, USA) The area was calculated in relation with that in the (MC-; FGF2-) group at weeks in ratio Bone incorporation,...
Ngày tải lên: 20/06/2014, 04:20
Báo cáo sinh học: " Research Article Aλ3 λ1 , λ2 , Ω -Weighted Inequalities with Lipschitz r and BMO Norms" doc
... is called the The nonlinear elliptic partial differential equation d A x, du homogeneous A- harmonic equation or the A- harmonic equation, and the differential equation d A x, du B x, du 1.7 is called ... conjugate A- harmonic tensors,” Journal of Mathematical Analysis and Applications, vol 203, no 1, pp 278–288, 1996 S Ding, “Estimates of weighted integrals for differential forms,” Journal of Mathematical ... maximal operators and ı fractional integrals on non-homogeneous spaces,” Indiana University Mathematics Journal, vol 50, no 3, pp 1241–1280, 2001 T Iwaniec and A Lutoborski, “Integral estimates...
Ngày tải lên: 21/06/2014, 17:20
Chapter 052. Approach to the Patient with a Skin Disorder (Part 2) potx
... hair-bearing areas may be characterized by destruction of hair follicles Table 52-3 Common Dermatologic Terms Alopecia: Hair loss; it may be partial or complete Annular: Ring-shaped lesions Cyst: A soft, ... associated with xerosis and aged skin Systemic conditions that can be associated with pruritus include chronic renal disease, cholestasis, pregnancy, malignancy, thyroid disease, polycythemia vera, and ... epidermis without an associated loss of dermis Ulcer: Loss of epidermis and at least a portion of the underlying dermis Excoriation: Linear, angular erosions that may be covered by crust and are caused...
Ngày tải lên: 06/07/2014, 20:20
Báo cáo toán học: "Asymptotics of the average height of 2–watermelons with a wall" pps
... case of 2– watermelons with a wall • In appendix A, we summarize background information on – Stirling’s approximation, – certain residues and values of the gamma and zeta function, – a certain ... + ca,0 a + k=1 ca,b = 4a k−1 a! k! ( 2a − 2k)! 1 ¯ ¯ ta−k− a k (t) ϑ(t) − [a = k] dt for a > 0, ( 2a) ! (2b)! 4a+ b−1 (a + b)! −2 a+ b + (−1 )a+ b ( 2a + 2b)! a! b! a b + k=0 j=0 ∞ × ∞ ∞ ¯ ¯ ta+b− a ... Gessel and X.G Viennot Determinants, paths, and plane partitions preprint, available at http://www.cs.brandeis.edu/˜ira/papers/pp.pdf, 1989 [13] R L Graham, D.E Knuth, and O Patashnik Concrete Mathematics...
Ngày tải lên: 07/08/2014, 15:23
Working with a study budy 2 pps
... had a hard day I wish you could take the day off tomorrow; you’ll look into arranging for that soon, if you can In the meantime, is there some way you can treat yourself, maybe take a short walk ... a different situation.’ I it every time!” Tim has a problem coming up with the right names, and Tameka has a problem when answer choices are very similar What Tim needs to is learn to associate ... for a specific reason: to learn! 143 CHAPTER In this chapter, you’ll be using what you’ve learned about reading closely, keeping calm, and using your learning styles to deal with tests that are...
Ngày tải lên: 07/08/2014, 22:20
Báo cáo khoa học: " Pre-segmented 2-Step IMRT with subsequent direct machine parameter optimisation – a planning study" ppsx
... cases with SIB), C: breast with parasternal lymph nodes or with protruding thoracic wall, D: angiosarcoma of the scalp, E: bone-metastasis partially surrounding the spine, F: bone metastasis with ... compare with international standards All clinical cases were primarily planned and optimised by DMPO The set of objective values was adapted according to the clinical requirements The head and ... surrounding a circular OAR (diameter cm) at a distance of 0.5 cm The body outside the PTV (Body\PTV) is considered as organ at risk Planning parameters and optimisation goals For all clinical cases...
Ngày tải lên: 09/08/2014, 09:22
Báo cáo khoa học: " Prospective phase II study of preoperative short-course radiotherapy for rectal cancer with twice daily fractions of 2.9 Gy to a total dose of 29 Gy - Long-term results" ppt
... writing and drafting of the manuscript JW: conception and design of the study, acquisition of data and data analysis AT: acquisition of data and data analysis DW: acquisition of data and data analysis ... The authors declare that they have no competing interests Authors' contributions All authors read and approved the final manuscript MG: acquisition of data and data analysis, statistical analysis, ... V, Abo-Madyan Y, Lorenz F, Wenz F, Mai S: A fast radiotherapy paradigm for anal cancer with volumetric modulated arc therapy (VMAT) Radiat Oncol 2009, 4:48 Weber DC, Wang H, Cozzi L, Dipasquale...
Ngày tải lên: 09/08/2014, 10:20
Báo cáo y học: "Treating patients with fibromyalgia in primary care settings under routine medical practice: a claim database cost and burden of illness study" docx
... (Apenins-Montigalà, Morera-Pomar, Montgat-Tiana, Nova Lloreda, and La Riera) that are managed by a health management organization (Badalona Serveis Assistencials S .A [BSA], Barcelona, Spain) and ... residences, or non-pharmacological treatments (massages, hydrotherapy, acupuncture, and so on) and that are not usually included in the BSA database and, as such, have not been taken into account in this ... not financed by the National Health System such as special diets or non-pharmacological treatments (such as massages or acupuncture) was not gathered as it was not included in the database In...
Ngày tải lên: 09/08/2014, 14:20