0 5 图表符号目录 list of tables figures symbols pdf

DECONTAMINATION OF CHEMICAL WARFARE SIMULANTS USING ELECTROSPUN MEDIA

DECONTAMINATION OF CHEMICAL WARFARE SIMULANTS USING ELECTROSPUN MEDIA

... electron density of the nucleus 1.2 Absorbance 0. 8 CD IBA 0. 6 IBA and CD CD derivative 0. 4 0. 2 0 200 400 600 800 100 0 1 200 Time Figure 3 .5: Change in absorbance (4 10 10 nm) for 15 hours 34 O Chapter ... Absorbance 0. 6 IBA 0. 5 IBA and CD 0. 4 CD derivative 0. 3 0. 2 0. 1 0 20 40 60 Time 80 100 1 20 Figure3.6: Change in the absorbance (at 4 10 10 nm) for the first 100 minutes The absorbance kinetics of paraoxon ... deviation PVC fibers 400 ± 30 nm, PVC with β-CD 4 50 20 nm, PVC with ΙΒΑ 4 20 20 nm, PVC with β-CD and IBA 4 50 10 nm, PVC with β-CD and IBA derivative 300 ± 20 nm When morphology of these functionalized...

Ngày tải lên: 10/09/2015, 15:48

167 576 0
Báo cáo y học: " Use of Non-parametric Item Response Theory to develop a shortened version of the Positive and Negative Syndrome Scale (PANSS)" potx

Báo cáo y học: " Use of Non-parametric Item Response Theory to develop a shortened version of the Positive and Negative Syndrome Scale (PANSS)" potx

... behaviour 0. 5 10 0.7 60 P5 Grandiosity 0. 4 95 0. 673 P1 Delusions 0. 4 95 0. 686 P4 Excitement 0. 467 0. 617 P2 Conceptual Disorganization 0. 455 0. 6 70 P6 Suspiciousness/Persecution 0. 4 10 0.6 50 P7 Hostility 0. 382 ... (6.92) 22.71 (6.93) - 0. 049 0. 961 - 0. 001 General 40. 82 ( 10. 09) 40. 85 ( 10. 14) - 0. 142 0. 887 - 0. 003 Total Score 82. 95 (19. 30) 83.13 (19. 60) - 0. 471 0. 638 - 0. 009 n (Percent) n (Percent) Sample ... Validation 359 3 359 4 Mean (sd) Mean (sd) t (71 85) p 39.49 (12.21) 39.43 (12.27) 0. 048 0. 962 0. 0 05 Positive 19.43 (6. 60) 19 .57 (6. 80) - 0. 961 0. 373 - 0. 021 Negative 22. 70 (6.92) 22.71 (6.93) - 0. 049 0. 961...

Ngày tải lên: 11/08/2014, 16:20

63 464 0
Tài liệu USE OF INTERPRETERS FOR NON-ENGLISH SPEAKING PERSONS pdf

Tài liệu USE OF INTERPRETERS FOR NON-ENGLISH SPEAKING PERSONS pdf

... Approved Interpreter List ’ be inserted, effective November 5, 200 8, as follows: USE OF INTERPRETERS FOR NON-ENGLISH SPEAKING PERSONS INTRODUCTION Pursuant to the inherent powers of the Court and ... Nonpayment of any required renewal fees; or Violation of the Code of Professional Responsibility for Court Interpreters Commentary: The appropriateness of disciplinary action and the degree of discipline ... nature of the charge or the type of case before the court, the purpose of the proceedings and function of the court, the rights of a party or criminal defendant, and the responsibilities of a witness)...

Ngày tải lên: 10/12/2013, 05:15

22 617 2
Use of an extension of the park's transformation to determine control laws applied to a non sinusoidal permanent magnet synchronous motor

Use of an extension of the park's transformation to determine control laws applied to a non sinusoidal permanent magnet synchronous motor

... : 1 ~ 100 2 10 2 40 t ora Figure 3: @ I m , @Irp , p and @Irq the position of the rotor versus Several control laws have been simulated with this motor and their performance compared 1 200 Voltage ... pC "0) which defmes "pseudo d q " axes, so that @Ird = 0. As io = , the expression of the torque of the motor will be nearly the same as the expression for a sinusoidal drive: T, = p.@', (0) i, ( 10) ... during the 1 20" inkrval of electrical angle where Wra is near of its maximal value @', supplied with a negative voltage -E during the 1 20" interval of eltvtrical angle where @Im is near of its minimal...

Ngày tải lên: 03/01/2014, 19:50

6 443 2
Báo cáo khoa học: "Unsupervised Recognition of Literal and Non-Literal Use of Idiomatic Expressions" potx

Báo cáo khoa học: "Unsupervised Recognition of Literal and Non-Literal Use of Idiomatic Expressions" potx

... hair out all literal 16 39 20 688 17 34 11 862 non-literal 25 142 1 50 52 1 2 15 1 40 255 53 2 4 70 272 172 1 25 54 3 102 all 25 144 166 46 54 1 903 157 262 56 6 15 478 281 1 75 126 61 3964 Table 1: Idiom ... Rl Fl CForm 78. 25 - Rep 79 .06 70. 00 5. 96 10. 98 Graph 79.61 52 .21 67.87 59 .02 LC 80. 50 62.26 26.21 36. 90 LC-O 80. 42 53 .89 69 .03 60. 53 Super 95. 69 84.62 96. 45 90. 15 Table 2: Accuracy, literal precision ... “literal” (5 30 items, 472 of which are correct) than as “nonliteral” (373 items, 157 correct) Accuracy 68 .00 79.17 37. 35 11.11 47.82 85 .03 69.66 64.33 82.44 82.33 60. 00 98. 95 85. 41 83.43 88.89 93. 65 49.18...

Ngày tải lên: 17/03/2014, 22:20

9 395 0
Báo cáo khoa học: "Use of soft X-radiography for early non-destructive detection of floral differentiation in Douglas fir buds" pptx

Báo cáo khoa học: "Use of soft X-radiography for early non-destructive detection of floral differentiation in Douglas fir buds" pptx

... chromosomic damage appeared, because of the small doses of radiation accumulated ( 25 rads for seems h of exposure which represents about 12 to the LD about , 50 20 000 rads for seeds, or to the doses ... apple or pear buds (2 00 0 to 00 0 rads) Improvements in the definition of radiographs can be expected and we are confident that there will be greater future developments of this technique in biology ... alternated (2 .5 d in water with 2 .5 d out of water over 15 d) Trees and were treated with hormonal injection and bark girdles Gibberellin 4/7 ( 20 mg) and naphthalene acetic acid (2 mg), in 100 μl...

Ngày tải lên: 08/08/2014, 19:21

9 243 0
Báo cáo y học: " Gender-specific profiles of tobacco use among non-institutionalized people with serious mental illness" ppsx

Báo cáo y học: " Gender-specific profiles of tobacco use among non-institutionalized people with serious mental illness" ppsx

... pension (yes v no) 0. 9 0. 7 0. 6 - 1.1 0. 5 - 1.1 0. 8 0. 6 0. 5 - 1.2 0. 4 - 1 .0 0.8 1 .0 0 .5 - 1.3 0. 6 - 1.6 Earned income/paid work (yes v no) 0. 8 0. 5 - 1.1 0. 7 0. 4 - 1.1 0. 8 0. 5 - 1.3 Social assistance/welfare ... (referent) 2 .0* ** 1 .0 Age Group 17-29 years 2.6* 1.2 5. 8 NI – 2.8* 1 .0 8 .0 30- 49 years 1.4 0. 8 2 .5 – – 1 .0 0 .5 2 .0 50 - 59 years 1.8* 1 .0 3.1 – – 1.7 0. 9 3 .5 60+ years (referent) 1 .0 – 1 .0 – Racialised ... 26.6 104 25. 7 77 27.9 1 70 23 .5 553 76 .5 108 324 25 .0 75 .0 62 229 21.3 78.7 Single and never married 453 63 .0 289 67 .5 164 56 .4 Separated/Divorced c2 (df), sig.2 Gender (n = 719) 8 .0 (1), p = 00 5...

Ngày tải lên: 11/08/2014, 16:22

12 244 0
báo cáo khoa học: " Non-medical use of opioids among HIV-infected opioid dependent individuals on opioid maintenance treatment: the need for a more comprehensive approach" docx

báo cáo khoa học: " Non-medical use of opioids among HIV-infected opioid dependent individuals on opioid maintenance treatment: the need for a more comprehensive approach" docx

... 0. 37) 0. 16 ( -0. 09; 0. 39) -0. 69 ( -0. 96 ; -0. 43) -0. 24 ( -0. 45; 0. 00) -0. 13 ( -0. 39; 0. 08) 0. 15 ( -0. 07; 0. 40) 0. 91 (0. 67; 1. 20) 0. 45 (0. 29; 0. 62) 0. 62 (0. 44; 0. 81) 0. 98 0. 20 -3 < 10 0 .03 0. 22 0. 20 ... < 10 -3 < 10 -3 < 10 -0. 24 ( -0. 49; -0. 01) -0. 68 (-1.17; -0. 28) 0. 34 (0. 18; 0. 52 ) 0. 81 (0. 56 ; 1 .07 ) -0. 56 ( -0. 86; -0. 32) -1 .00 (-1. 35; -0. 76) 0. 06 0. 003 -3 < 10 -3 < 10 -3 < 10 -3 < 10 < 10 0 .03 0. 20 ... 0. 20 -3 < 10 0 .01 0. 06 16 [7- 30] 366 (34.9) 57 (5. 5) 3 95 (37.4) 824 (78.4) 124 32 119 196 -0. 29 ( -0. 39; -0. 22) -0. 25 ( -0. 46; -0. 03) -0. 26 ( -0. 65; 0. 15) -0. 52 ( -0. 70; -0. 30) -0. 33 ( -0. 62; 0. 10) 676...

Ngày tải lên: 11/08/2014, 18:20

23 217 0
Báo cáo y học: " Use of different but overlapping determinants in a retrovirus receptor accounts for non-reciprocal interference between xenotropic and polytropic murine leukemia viruses" ppt

Báo cáo y học: " Use of different but overlapping determinants in a retrovirus receptor accounts for non-reciprocal interference between xenotropic and polytropic murine leukemia viruses" ppt

... UUUU x 106 x 104 AAAA < 10 20 UUAA < 10 80 AAUU x 1 05 x 104 UAAU x 104 x 103 AUUA x 106 10 UUUA x 1 05 < 10 AAAU AAUA No added receptor x 1 05 x 104 x 106 30 < 10 20 Figure of Analysis human/hamster ... 60 30 1 50 CHO/AAUA cells 1 20 AKR6 + 83A 25 + secondary antibody 83A 25 + secondary antibody 90 60 30 1 50 CHO/AAAU cells 1 20 90 AKR6 + 83A 25 + secondary antibody 83A 25 + secondary antibody 60 30 ... MEGPAFSKPLKDKINPWGPLIVLGILIRAGVSVQHDSPHQVFNVTWRVTNLMTGQTANATSLLGTMTDAFPMLYFDLCDL 80 80 80 80 NZB AKR6 1E FrMCF 90 100 1 10 1 20 1 30 1 40 1 50 1 60 VGDYWDDPEPDIGDGCRTPGGRRRTRLYDFYVCPGHTVPIGCGGPGEGYCGKWGCETTGQAYWKPSSSWDLISLKRGNTP...

Ngày tải lên: 13/08/2014, 09:21

12 229 0
common errors in the use of the english passive made by the grade 10 non-english majors at tran phu specialised high school, hai phong = những lỗi thường gặp ở thể bị động của học sinh không chuyên khối 10

common errors in the use of the english passive made by the grade 10 non-english majors at tran phu specialised high school, hai phong = những lỗi thường gặp ở thể bị động của học sinh không chuyên khối 10

... results Number of students: 70 Options A Questions 10 B c d e 10% 45% 85% 50 % 20% 15% 55 % 80% 40% 30% 25% 50 % 10% 6% 80% 25% 17% 85% 60% 70% 60% 5% 5% 60% 60% 28% - 5% 0% 24% 0% - - Table 10: Survey ... (Number of students: 70) Part Item I II III IV 10 11 12 13 14 15 100 % 45% 67% 80% 90% 30% 100 % 20% 95% 40% 100 % 97% - 58 % 77% 70% 97% 74% 67% 37% 11% 72% 56 % 60% 65% 51 % 12% 87% 40% 60% 45% 34% 56 % ... 47 Probable causes of the errors 50 Measures to overcome these errors 52 PART III – CONCLUSION 55 References Appendix Appendix ii Abbreviations E.A: Error analysis Lists of tables and charts Chart1:...

Ngày tải lên: 02/03/2015, 14:30

62 962 4
AN INVESTIGATION INTO THE USE OF ROLE PLAY FOR ENHANCING THE SECOND YEAR NON- ENGLISH MAJOR STUDENTS’ SPEAKING PERFORMANCE AT HANOI UNIVERSITYOF BUSINESS AND TECHNOLOGY Nghiên cứu về việc sử dụng đóng vai tình huống để nâng cao khả năng nói tiếng Anh của

AN INVESTIGATION INTO THE USE OF ROLE PLAY FOR ENHANCING THE SECOND YEAR NON- ENGLISH MAJOR STUDENTS’ SPEAKING PERFORMANCE AT HANOI UNIVERSITYOF BUSINESS AND TECHNOLOGY Nghiên cứu về việc sử dụng đóng vai tình huống để nâng cao khả năng nói tiếng Anh của

... seat positions Of the same ability 50 83.3 1.7 Of mixed ability Others 0 At random 10 Table 5: Students’ preference for choosing pairs or groups From the above table, a large number of the respondents ... way of group forming is time- saving However, out of 60 students, which accounts for 10% , showed their preference of being chosen at random Only 1.7% and 5% of them indicated their favor of being ... idea Sometimes 10 Never 3.3 Always 34 56 .7 Often 18 30 Sometimes 8.3 Never Always 6.7 Often 11.6 Sometimes 12 20 Never 37 61.7 and take notes their ideas b I spend some time thinking of the c I am...

Ngày tải lên: 30/03/2015, 14:01

84 887 0
The relationship between the use of vocabulary learning strategies and learner autonomy of the first year non-major English students at Thainguyen University of Technology

The relationship between the use of vocabulary learning strategies and learner autonomy of the first year non-major English students at Thainguyen University of Technology

... English proficiency Asian EFL Journal, 24/1, 1- 20 Retrieved November 24, 200 8 from the World Wide Web: http://www.asian-efl-journal.com/pta_nov _07 _dd .pdf 13 Fan, Y M ( 200 3) Frequency of use, perceived ... Learner Autonomy of ELT students A Ph.D Dissertation, Cukurova University Retrieved September 12, 200 8 from the World Wide Web: http://www.library.cu.edu.tr/ 6 05 8 .pdf 20 Le Van Huy ( 200 7) Using SPSS ... http://www.dogus.edu.tr/dogustru/journal/sayi_1/m 000 16 .pdf 35 Vera, E Arias, L & Buitrgo, Z (n.d) Building Up Learners’ Autonomy and Cooperative Assessment Retrieved November 18, 200 8 from the World Wide Web: http://pedagogica.edu.co: 808 0/w3/storage/folios/articulous/folios...

Ngày tải lên: 04/08/2015, 09:41

5 477 1
The use of the Internet tool as an assistance for first-year non-major students at Namdinh University of Technology Education in basic English self-study

The use of the Internet tool as an assistance for first-year non-major students at Namdinh University of Technology Education in basic English self-study

... Error 0. 51 4397962 0. 494 708 846 Standard Deviation 2. 300 457 62 2.212 4 05 217 Sample Variance 5. 292 1 05 263 4.894736842 Range 8 Sum 223 2 90 Count 20 20 Confidence Level( 95 .0% ) 1 .07 6647 3 05 1 .03 54 3 751 2 Table ... 4.723684211 4. 852 63 157 9 Range 7 Sum 2 15 226 Count 20 20 Confidence Level( 95 .0% ) 1 .01 7184 301 1 .03 0974398 The tables indicate the positive influence of using web-based listening activities in the self-study ... Variance 4.894736842 4. 852 63 157 9 Observations 20 20 Pooled Variance 4.873684211 Hypothesized Mean Difference df 38 t Stat 4 .58 3 753 826 P(T

Ngày tải lên: 04/08/2015, 09:41

15 565 0
Common errors in the use of the English passive made by the grade 10 Non-English Majors at Tran Phu Specialised High School, Hai Phong

Common errors in the use of the English passive made by the grade 10 Non-English Majors at Tran Phu Specialised High School, Hai Phong

... Publishers Limited, 200 3 13 Micheal Swan Practical English Usage (Third Edition) Oxford University Press, 200 5 14 Quirk, R and S Greenbaum and G.Leech and J Svartrick A grammar of contemporary English ... various and different in the way of making errors However, because of limited size, the study will concentrate on giving an analysis of errors made by only 70 students from two non-major classes ... presented in the later parts of the study From the analysis of the data, the problems will be found and the solutions will be given V Organization of the study: The study consists of three parts: Introduction,...

Ngày tải lên: 10/08/2015, 19:51

3 418 0
Use of DDGS in Swine Diets

Use of DDGS in Swine Diets

... (P < 10) 05 - Use of DDGS in Swine Diets Table 3: Muscle Quality Characteristics from Grower-Finisher Pigs Fed Diets Containing 0, 10, 20, and 30% DDGS 0% 10% 20% 30% c 54 .3 55 .1 55 .8 55 .5 L* ... ileal digestible lysine (1. 35 and 1. 15% ) and methionine + cystine (0. 80 and 0. 65% ), ME (33 40 and 33 90 kcal/kg), calcium (0. 95 and 0. 80% ) and total phosphorus (0. 80 and 0. 70% ) within Phases and 3, ... Characteristics of Market Hogs Fed Corn-Soybean Meal Diets Containing 0, 10, 20 and 30% DDGS 0% 10% 20% 30% DDGS DDGS DDGS DDGS 3.15a 3 .00 ab 2.84bc 2.71c Belly thickness, cm 24.4a 25. 1a 21.3b 27.3a...

Ngày tải lên: 08/08/2012, 10:03

15 844 1
Báo cáo y học: "Use of chinese and western over-the-counter medications in Hong Kong"

Báo cáo y học: "Use of chinese and western over-the-counter medications in Hong Kong"

... 1.14 (0. 93, 1.39) NS 0. 90 (0. 79, 1 .02 ) NS 60- 69 0. 93 (0. 73, 1.19) NS 0. 73 (0. 63, 0. 85) < 0. 001 0. 50 (0. 38, 0. 67) < 0. 001 0. 49 (0. 42, 0. 57 ) < 0. 001 < 0. 001 Reference 1 .03 (0. 96, 1. 10) NS Age 70 or ... Reference Primary 0. 66 (0. 52 , 0. 85) 0. 001 Reference 0. 94 (0. 71, 1.26) Secondary 0. 69 (0. 53 , 0. 89) 0. 004 0. 85 (0. 64, 1. 15) NS Tertiary 0. 49 (0. 36, 0. 66) < 0. 001 0. 72 (0. 51 , 1 .03 ) NS NS Marital ... 1.49 (1.11, 2 .01 ) 0. 009 60- 69 1. 40 (1 .06 , 1.86) 0. 0 20 2 .08 (1.48, 2.92) < 0. 001 1. 75 (1. 30, 2. 35) < 0. 001 1.98 (1.38, 2.84) < 0. 001 < 0. 001 Reference 0. 94 (0. 81, 1. 10) NS Age 70 or above Education...

Ngày tải lên: 25/10/2012, 10:06

9 521 0
Báo cáo y học: "Use of the measure your medical outcome profile (MYMOP2) and W-BQ12 (Well-Being) outcomes measures to evaluate chiropractic treatment: an observational study"

Báo cáo y học: "Use of the measure your medical outcome profile (MYMOP2) and W-BQ12 (Well-Being) outcomes measures to evaluate chiropractic treatment: an observational study"

... 01 5 -.221* 107 3 20 018 05 8* 6 75 Activity (A) rs p (2-tailed) -.229* 103 - .03 7* 792 -.268* 05 8 05 8* 682 Wellbeing (WB) rs p (2-tailed) - 51 2 < 00 1 -.311 02 2 -.4 45 00 1 358 00 8 Profile (P) rs p (2-tailed) ... (0. 9) 1.6 (1 .0) 1.4 (1 .5) 7.1 (2 .5) 1.4 (1.3) 6.9 (2 .5) 1 .0 (1.3) 7.7 (2 .5) Positive well-being PWB 8.6 (2 .5) 8 .5 (4.4) 10. 0 (4.4) General well-being GWB 26.1 (5. 4) 25. 8 (5. 8) 28.6 () Mean W-BQ12 ... (EQ-5D) Quality of Life Research 200 0, 9 :52 1-27 Jarosz BS: Chiropractic treatment of chronic patellar tendinopathy in a professional basketball player: a case report Chiropr J Aust 201 0, 40( 1):3-8...

Ngày tải lên: 25/10/2012, 10:06

8 539 0
w