The PHCP protein sequence 135 amino acids deduced from the cloned gene is the most homologous 55% iden-tity to that of cytochrome c¢ from Allochromatium vinosum AVCP.. Strikingly, PHCP w
Trang 1Escherichia coli is not dependent on the System I
cytochrome c biogenesis machinery
Hiroki Inoue1, Satoshi Wakai1, Hirofumi Nishihara2and Yoshihiro Sambongi1
1 Graduate School of Biosphere Science, Hiroshima University, Japan
2 Faculty of Agriculture, Ibaraki University, Japan
Introduction
Cytochromes c¢ are classified as class II cytochromes c
according to Ambler [1], and are found in the
peri-plasm of certain Gram-negative Alpha-, Beta- and
Gammaproteobacteria Recent biochemical and genetic
analyses have demonstrated that cytochromes c¢
mainly play roles in the cellular metabolism of nitric
oxide [2], which is an electron acceptor in denitrifying
bacteria and is also implicated as a signaling molecule
in a wide range of organisms
The structure of cytochromes c¢ exhibits clear
differ-ences from that of the well-known Ambler’s class I
cytochromes c The class I cytochromes c are spherical
proteins with a hexacoordinate heme covalently bound
near their N-termini In contrast, cytochromes c¢, con-sisting of approximately 130 residues, contain a penta-coordinate heme located towards the C-terminus of a four-helix bundle protein Escherichia coli cyto-chrome b562 (EC b562), a 106-residue protein, also has
a four-helix bundle structure with a noncovalently bound heme [3] Despite the sequence difference between cytochromes b562 and c¢, the four helices of each nearly spatially coincide when the respective heme groups are superimposed [4]
Although knowledge concerning the function and structure of cytochromes c¢ has accumulated, their biogenesis remains unclear In general, covalent heme
Keywords
cytochrome c biogenesis; cytochrome c¢;
Escherichia coli; heterologous synthesis;
System I
Correspondence
Y Sambongi, Graduate School of Biosphere
Science, Hiroshima University, 1-4-4
Kagamiyama, Higashi-Hiroshima, Hiroshima
739-8528, Japan
Fax: +81 824 24 7924
Tel: +81 824 24 7924
E-mail: sambongi@hiroshima-u.ac.jp
(Received 28 February 2011, revised 5 April
2011, accepted 27 April 2011)
doi:10.1111/j.1742-4658.2011.08155.x
Hydrogenophilus thermoluteolus cytochrome c¢ (PHCP) has typical spectral properties previously observed for other cytochromes c¢, which comprise Ambler’s class II cytochromes c The PHCP protein sequence (135 amino acids) deduced from the cloned gene is the most homologous (55% iden-tity) to that of cytochrome c¢ from Allochromatium vinosum (AVCP) These findings indicate that PHCP forms a four-helix bundle structure, similar to AVCP Strikingly, PHCP with a covalently bound heme was heterologously synthesized in the periplasm of Escherichia coli strains deficient in the DsbD protein, a component of the System I cytochrome c biogenesis machinery The heterologous synthesis of PHCP by aerobically growing
E coli also occurred without a plasmid carrying the genes for Ccm pro-teins, other components of the System I machinery Unlike Ambler’s class I general cytochromes c, the synthesis of PHCP is not dependent on the System I machinery and exhibits similarity to that of E coli periplasmic cytochrome b562, a 106-residue four-helix bundle
Database The sequence data reported here have been deposited in the DDBJ database under accession
Abbreviations
AVCP, Allochromatium vinosum cytochrome c¢; Ccm, cytochrome c maturation; Dsb, disulfide bond formation; EC b 562 , Escherichia coli cytochrome b562; PHCP, Hydrogenophilus thermoluteolus cytochrome c ¢; PH c 552 , Hydrogenophilus thermoluteolus cytochrome c552.
Trang 2attachment to class I cytochromes c is catalyzed by the
cellular machinery, resulting in cytochrome c
biogene-sis [5] For example, in some Gram-negative bacteria,
such as E coli, the System I cytochrome c biogenesis
machinery, consisting of some disulfide bond
forma-tion (Dsb) and cytochrome c maturation (Ccm)
proteins, is responsible for the biogenesis of a wide
variety of both endogenous and exogenous class I
cy-tochromes c [6] Successful heterologous synthesis of
several cytochromes c¢ has been reported using
aerobi-cally growing E coli with co-expressed ccm genes from
a plasmid [7–9] However, a variant of EC b562, which
has been mutated so as to bind heme covalently like
cytochromes c, can be formed as a holo-protein
with-out co-expressed ccm genes from a plasmid [10,11]
Although the heme-binding mode of the resulting
EC b562 variant differs from that with co-expressed
ccm genes from a plasmid, its holo-formation is
obvi-ous This prompted us to re-examine the heterologous
synthesis of cytochromes c¢ with or without
co-expressed ccm genes from a plasmid In addition, the
effects of Dsb proteins on cytochrome c¢ synthesis
have not been examined to date
In this study, we examined the heterologous synthesis
of cytochrome c¢ proteins by E coli strains deficient in
the DsbD protein and co-expressing or not
co-express-ing ccm genes from a plasmid For this purpose, we first
purified and characterized Hydrogenophilus
thermoluteo-lus cytochrome c¢ (PHCP) Secondly, the PHCP gene
was cloned for sequence and expression analyses
Heter-ologous synthesis of the PHCP protein by the E coli
strains was investigated in direct comparison with that
of H thermoluteolus cytochrome c552 (PH c552), which
is a typical class I cytochrome c that has been
demon-strated to be System I dependent with regard to its
bio-genesis in E coli [12,13] Our results provide
information on the biogenesis of cytochromes c¢, which
has not been studied systematically
Results
Purification of the PHCP protein
The PHCP protein was purified to homogeneity by
col-umn chromatography, as illustrated on an SDS⁄ PAGE
gel (Fig 1) The estimated molecular weight of the
PHCP protein on the gel was 13 kDa, which was close
to that of other cytochromes c¢ isolated from various
bacteria The N-terminal amino acid sequence of
PHCP was determined up to the 30th residue, as
illus-trated inFig 2 A blast search indicated that the
pro-tein sequence determined up to the 30th residue was
homologous to that of other cytochromes c¢ isolated
from other bacteria Thus, at this stage of the present work, we concluded that the purified PHCP protein was a novel cytochrome c¢ isolated from H thermolute-olus
Spectral properties of the authentic PHCP protein Visible absorption spectra of the authentic PHCP pro-tein purified from H thermoluteolus were obtained to examine the local heme environment in the protein interior The spectra of the oxidized and reduced PHCP were essentially the same as those reported for other cytochromes c¢ (Fig 3A), indicating that the heme environment in the PHCP protein was similar to that in others Specifically, a Soret band at 425 nm was observed for the reduced form of PHCP, which is characteristic of a pentacoordinate heme with a His residue as an axial ligand [14] Furthermore, a peak around 630 nm was observed for the oxidized form of PHCP, indicating that the position of the sixth ligand
to the heme iron is empty, as discussed for other cyto-chromes c¢ [14] In addition, the a-band in the pyridine hemochrome spectrum of reduced PHCP corresponded
to 550 nm, which is indicative of the covalent bonding
of heme vinyl groups to the protein via two thioether linkages
A far-UV CD spectrum (190–260 nm) was obtained
to examine the secondary structure of the PHCP
75
25 20 15
10 5
5
Fig 1 Purification of the Hydrogenophilus thermoluteolus cyto-chrome c¢ (PHCP) protein Lane 1, total soluble extract of H therm-oluteolus cells; lane 2, HiTrap Q batch elution with 0.2 M NaCl; lane
3, HiTrap Q linear gradient elution with 0–0.2 M NaCl; lane 4, HiTrap SP flow-through elution; lane 5, Sephadex 75 elution The arrow indicates the position of PHCP One to ten micrograms of protein were loaded per lane, and the gel was stained with Coo-massie Brilliant Blue.
Trang 3protein From the ellipticity peak height of the PHCP
protein at 222 nm (Fig 3B), its helical content was
cal-culated to be 60.3% [15] This value is close to the
a-helical content of Allochromatium vinosum
cyto-chrome c¢ (AVCP), i.e 63.0%, which was calculated
directly from its primary (Fig 2) and
three-dimen-sional [16] structures
Cloning of the PHCP gene
PCR with mixed primers PHcp01fw and PHcp01rv,
using H thermoluteolus chromosomal DNA as a
tem-plate, gave a DNA fragment of approximately 360 bp,
which was then cloned into the pUC19 vector At least
five independent clones were sequenced, and the amino
acid sequence (25th to 125th residues, Fig 2) deduced
from the DNA was homologous to the sequences of
cytochromes c¢ deposited previously in the database
Using the inverse PCR method, we obtained a single
6.5-kbp DNA fragment from an SphI-digested
H thermoluteolus chromosomal DNA library DNA
sequencing of the fragment revealed that the product
contained the 5¢ and 3¢ ends of the PHCP gene plus
putative promoter, Shine–Dalgarno and transcriptional
terminator sequences From the deduced sequence, the
mature PHCP was found to consist of 135 amino
acids, and the N-terminal Asp was preceded by a
Sec-dependent periplasmic targeting signal peptide of 19
amino acid residues (Fig 2) This indicates that the PHCP protein is synthesized as a precursor, and that its signal peptide is cleaved off during translocation to the periplasm of H thermoluteolus cells
From the amino acid sequence deduced from the cloned PHCP gene, the heme-binding motif observed
in general cytochromes c, Cys–X–X–Cys–His, was found to be located close to the C-terminus of the PHCP protein, which is conserved in other biochemi-cally characterized cytochromes c¢ (Fig 2) The mature PHCP protein exhibited overall sequence identity of 54.8% to AVCP, this being the highest identity among the homologs in the genome database
Heterologous synthesis of the PHCP and PH c552 proteins by E coli
The cloned PHCP gene, together with the typical class I PH c552gene as a reference control, was exam-ined with regard to its heterologous expression in various E coli strains by means of heme-specific stain-ing of SDS⁄ PAGE gels On such gels, when stained materials are observed at positions coinciding with those of PHCP and PH c552, the proteins each have a covalently attached heme, which is defined here as completion of cytochrome c synthesis
The PHCP protein was heterologously synthesized
in the periplasm of anaerobically growing E coli dsbD
20 30 40 50 60 70
80 90 100 110 120 130
1 10
mkriamitaltlcaaaahaDALKPEDKVKFRQAS mkhvlastaaglmalgl-assaiaAGLSPEEQIETRQAG mkklstlaalacmtvgsll-atsaqaQFAKPEDAVKYRQSA mrrvllatlmaalpaaaMAADAEHVVEARKGY
(1) H thermoluteolus (2) A vinosum (3) A xylosoxidans (4) R sphaeroides
YTTMAWNMGKIKAMVVDGTMPFSQTQVSAAANVIAAIANSGMGALYSPDTLGVVGFKKSR YEFMGWNMGKIKA-NLEGE YNAAQVEAAANVIAAIANSGMGALYGPGTDKNVGDVKTR LTLMASHFGRMTP-VVKGQAPYDAAQIKANVEVLKTLSAL-PWAAFGPGTEGG-D -FSLVALEFGPLAAM-AKGEMPYDAAAAKAHASDLVTLTKYDPSDLYAPGTSAD-DVKGTA
LKENFFQEQDEVRKIATNFVEQANKLAEVAAMGDKDEIKAQFGEVGKACKACHEKFREEE VKPEFFQNMEDVGKIAREFVGAANTLAEVAATGEAEAVKTAFGDVGAACKSCHEKYRAK-ARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKKK AKAAIWQDADGFQAKGMAFFEAVAALEPAAGAGQKE-LAAAVGKVGGTCKSCHDDFRVKR
* ** * *
* * * *
Fig 2 Multiple sequence analysis of biochemically characterized cytochrome c¢ proteins Experimentally determined signal peptides are depicted in lower case letters The numbering on the Hydrogenophilus thermoluteolus cytochrome c¢ (PHCP) sequence is that of the mature protein The sequence of PHCP was chemically determined up to the 30th residue in this study and confirmed by the protein sequence deduced from the cloned gene The stretches of the PHCP amino acid sequence used for the design of the PCR primers are underlined with arrows indicating the 5¢ to 3¢ direction The sequences of biochemically characterized cytochromes c¢ were obtained from a database: (2) locus tag of Alvin_2765 of Allochromatium vinosum DSM180; (3) accession number P00138 of Achromobacter xylosoxidans NCIMB11015; (4) locus tag of RSP_0474 of Rhodobacter sphaeroides 2.4.1 The consensus cytochrome c Cys–X–X–Cys–His heme-binding motif is close to the C-terminus of each protein Gaps in the alignment are indicated by dashes Identical residues to those in PHCP are highlighted in gray Helical regions determined from the crystal structure of A vinosum cytochrome c¢ (AVCP) are underlined A residue occupying the empty sixth ligand to the heme iron and hydrophobic residues in contact with the heme in the AVCP structure are indicated by asterisks above the sequence (see details in the Discussion section).
Trang 4null mutant strain RI242, whereas the PH c552 protein
was not (Fig 4) The isogenic wild-type E coli RI89
strain with the intact DsbD protein was able to
heter-ologously synthesize the PHCP and PH c552 proteins,
confirming that the observed difference between
the two proteins in the RI242 strain is a result of the
absence of the DsbD protein
PHCP was also synthesized as a holo-protein in the
periplasm of aerobically growing E coli JCB387 cells
not harboring the pEC86 plasmid carrying the ccm
genes (Fig 4) In contrast, when it did not harbor the
plasmid, the E coli JCB387 strain was not able to
produce PH c552aerobically These results indicate that the present growth conditions in the absence of pEC86
do not confer the cytochrome c biogenesis ability to the PH c552 protein This is possibly a result of the shortage of Ccm proteins, because the expression of ccm genes is repressed under aerobic growth condi-tions
In the presence of the pEC86 plasmid, both the PHCP and PH c552 proteins were heterologously syn-thesized in the periplasm of E coli JCB387 cells (Fig 4) Judging from the staining intensity, the level
of production of the PHCP protein in the presence of the pEC86 plasmid was significantly lower than that without the plasmid, indicating that the co-expression
of plasmid-borne ccm genes represses PHCP overpro-duction by aerobically growing E coli cells A similar difference in the PHCP production level was observed
in the early and late logarithmic and stationary phases
of E coli JCB387 cells with and without the pEC86 plasmid
Spectral properties of PHCP heterologously synthesized by E coli
The visible absorption spectra of periplasmic extracts containing the PHCP protein heterologously synthe-sized by E coli RI242 and JCB387 without pEC86 were the same as those observed for the authentic
Wavelength (nm)
Oxidized PHCP Reduced PHCP
300 400
425
630
0.0
0.1
0.2
0.3
0.4
0.5
0.6
–20
–10
0
10
20
30
40
2 ·dmol
Wavelength (nm) 222
B
A
Fig 3 Spectral analysis of the authentic Hydrogenophilus
thermo-luteolus cytochrome c¢ (PHCP) protein: (A) visible absorption
spec-tra; (B) CD spectra Specific wavelengths referred to in the text are
indicated by arrows in (A) and (B).
20
–pEC86
Mw (kDa)
15
10
*
5
RI89
+pEC86
Fig 4 Heterologous synthesis of cytochromes c by Escherichia coli strains Periplasmic extracts (equivalent to 5 · 10 8
cells) of the
E coli RI242 and RI89 strains, and the JCB387 strain without (indi-cated by –) or with (indi(indi-cated by +) the pEC86 plasmid carrying the ccm genes, were analyzed by heme staining after SDS ⁄ PAGE In each lane of the gel, periplasmic extracts from the E coli cells transformed with the Hydrogenophilus thermoluteolus cyto-chrome c¢ (PHCP) and H thermoluteolus cytocyto-chrome c 552 (PH c 552 ) genes are indicated as c¢ and c 552 , respectively The arrow and arrowhead indicate the positions of the PHCP and PH c552proteins, respectively The band denoted by the asterisk on the right-hand side is the result of nonspecific staining of the extracts containing the PH c552protein.
Trang 5purified protein in both the oxidized and reduced
states (Fig 3A) These findings indicate that the heme
is correctly incorporated into the apo-form of PHCP
heterologously synthesized by E coli, even without the
DsbD protein and without co-expression of the ccm
genes from the pEC86 plasmid In addition, the
a-band in the pyridine hemochrome spectra of the
same periplasmic extracts with dithionite corresponded
to 550 nm, as observed for the authentic PHCP
pro-tein, indicating the covalent attachment of the heme to
the protein through two thioether bonds
Discussion
In this study, we attempted to determine whether or
not Ambler’s class II cytochromes c¢ are synthesized
by the System I cytochrome c biogenesis machinery
For this purpose, we first performed spectral analysis
of the authentic PHCP protein, aiming at the
predic-tion of its structure, which is the final state of
biogene-sis Secondly, the PHCP gene was cloned to gain
sequence information and to examine its heterologous
expression in E coli strains with reference to PH c552,
which has been characterized as a System I-dependent
cytochrome c
Spectral properties of the authentic PHCP protein
The visible absorption and CD spectral features of the
PHCP protein indicate that its local heme environment
and helical content are similar to those found in
typi-cal cytochromes c¢ In the four-helix bundle structure
of general cytochromes c¢, access to the sixth ligand
position with regard to the heme iron is hindered
primarily by the side-chains of aromatic or
nonaromat-ic hydrophobnonaromat-ic residues Such a responsible residue is
Tyr16 in the crystal structure of the AVCP protein
[16] The same residue is also conserved in the PHCP
protein (Fig 2)
Other residues responsible for the maintenance of
the hydrophobic environment around the heme in
AVCP are Met19, Gly20, Met23, Tyr61, Val76,
Phe80, Val87, Val95 and Val120 (PHCP numbering,
Fig 2), which directly face the heme group [16] Of
these nine residues, seven are identical in PHCP, the
other two, Gly20 and Val76, in AVCP being
homolo-gously replaced by Ala20 and Leu76, respectively, in
PHCP These sequence similarities, together with the
spectral properties observed for the PHCP and AVCP
proteins, indicate that the former has a
three-dimen-sional structure comprising a four-helix bundle, as
demonstrated for other cytochromes c¢, including the
latter
Heterologous synthesis of PHCP by E coli The E coli System I cytochrome c biogenesis machin-ery, consisting of the Dsb and Ccm proteins, is respon-sible for the synthesis of class I cytochromes c even from various exogenous sources [6] Normally, the
E coli chromosomal ccm genes are not aerobically expressed Therefore, through co-expression of the ccm genes in the pEC86 plasmid, together with various class I cytochrome c genes, holo-cytochromes c can be successfully overproduced by aerobically growing
E colicells In previous studies, it has been shown that co-expression of the ccm genes in the pEC86 plasmid
is required for the heterologous expression of class II cytochromes c¢ by E coli [7–9], predicting that cyto-chrome c¢ biogenesis is System I dependent However, systematic studies on the effects of the ccm and dsb genes with reference controls have not been performed
It is clear from our results that the co-expression of the ccm genes in the pEC86 plasmid and the presence
of the DsbD protein are not necessarily required for the heterologous synthesis of the PHCP protein by
E coli, unlike that of class I cytochromes c, including the PH c552protein
Similarity to and differences from periplasmic
EC b562
Previously, the c-type heme-binding Cys–X–X–Cys– His motif was introduced into periplasmic EC b562 in order to determine whether or not the resulting variant
is synthesized as a holo-protein with a covalently bound heme [10] Even without the DsbD protein or without co-expression of the ccm genes in a plasmid, the EC b562 variant can be formed as a holo-protein with a covalently bound heme [11] Although the pro-duction level and heme-binding mode of the EC b562 variant under these conditions differ from those with the dsbD gene product or with the co-expression of the ccm genes in a plasmid, holo-protein synthesis clearly occurs with such an imperfect System I cytochrome c biogenesis machinery Therefore, the EC b562 variant resembles the PHCP protein in terms of biogene-sis, which is different from System I cytochrome c biogenesis
The above EC b562variant with the c-type heme-bind-ing Cys–X–X–Cys–His motif was further modified so as
to add extra Cys residues around the motif The result-ing variants were examined for heterologous synthesis
by E coli JCB387 with or without the pEC86 plasmid, it being shown that co-expression of the ccm genes in the plasmid caused enhanced levels of production of the variants [17] These observations are not consistent with
Trang 6those in the present study, in which the co-expression of
the ccm genes in the pEC86 plasmid was found to result
in a low level of production of PHCP (Fig 4) There is
presently no explanation as to why the production levels
differ between the PHCP protein and the EC b562
variant Further experiments on the two proteins with
the same growth medium and aerobicity are required for
a clear comparison, which will provide information on
the function of Ccm proteins
Structural implication for PHCP synthesis
Although the sequence identity is low between the
PHCP protein and the EC b562variant, they may have
the same architecture, comprising a four-helix bundle
structure, indicating that their folding mechanisms,
including heme attachment, are conserved, as
sug-gested previously [18] A large portion of the EC b562
protein can fold in the absence of heme to yield its
apo-form with an empty heme-binding site [19] Should
such a folding process in apo-EC b562 also occur in
apo-PHCP, the latter protein may incorporate free
heme, which is then spontaneously bound in a
System I-independent manner Although no direct
evi-dence for this is available, hydrophobic interactions
within apo-PHCP may facilitate protein folding in the
absence of heme, as observed for Aquifex aeolicus
class I cytochrome c555, whose apo-form is
exception-ally folded [20,21] It would be of interest to
investi-gate further the biogenesis mechanism for PHCP with
regard to the relation to its structural features in
conjunction with a mutagenesis study
Materials and methods
Purification of PHCP from H thermoluteolus
Hydrogenophilus thermoluteolus TH-1 [22] was cultured at
45C in an inorganic medium under H2: O2: CO2
(75 : 15 : 10) The constituents of this medium have been
given previously [23] The H thermoluteolus cells (30 g wet
weight) were resuspended in 210 mL of 10 mm Tris⁄ HCl
(pH 8.0) The cells were then disrupted with a French
pres-sure cell, followed by centrifugation (200 000 g) to obtain a
total soluble extract
The resulting soluble extract was dialyzed against 10 mm
Tris⁄ HCl (pH 8.0) at 4 C, and then loaded onto a
Hi-Trap Q anion-exchange column (diameter, 1.4 cm; height,
3 cm; GE Healthcare, Tokyo, Japan) that had been
equili-brated with 10 mm Tris⁄ HCl (pH 8.0) Batch elution was
carried out with 50 mL of the same buffer containing 0, 0.2
or 1.0 m NaCl, a red-colored fraction containing the PHCP
protein being eluted with 0.2 m NaCl The red-colored
fraction was further dialyzed against 10 mm Tris⁄ HCl (pH 8.0), and then loaded onto the same column that had been equilibrated with the same buffer Proteins were eluted with a linear gradient of NaCl (0–0.2 m) The resulting red fraction was dialyzed against 25 mm sodium acetate (pH 5.5), and then loaded onto a HiTrap SP cation-exchange column (diameter, 1.4 cm; height, 3 cm; GE Healthcare) that had been equilibrated with the same buf-fer The fraction containing the PHCP protein flowed through, and was finally separated by gel filtration on a column of Sephadex 75 (diameter, 1.6 cm; height, 60 cm;
GE Healthcare) that had been equilibrated with 25 mm sodium acetate (pH 5.5)
Characterization of the purified PHCP protein Protein purity during the column chromatography steps was checked by SDS⁄ PAGE and staining with Coomassie Brilliant Blue The gels were also subjected to heme stain-ing, proteins with covalently bound heme being stained to detect cytochrome c specifically [24] The band correspond-ing to the PHCP protein on a gel was blotted onto a polyv-inylidene fluoride membrane (Millipore, Tokyo, Japan) for direct protein sequencing analysis with an automatic protein sequencer (Applied Biosystems, Tokyo, Japan) The protein concentrations of the crude extracts were deter-mined with a protein assay kit (Bio-Rad, Tokyo, Japan) with bovine serum albumin as a standard For the purified PHCP protein, the concentrations were determined spectro-photometrically using the extinction coefficient at 205 nm caused by the peptide bond [25]
Visible absorption and CD spectra of the purified authentic PHCP protein in 10 mm potassium phosphate buffer (pH 7.0) were obtained with JASCO V-530 and JASCO J-820 spectrometers, respectively, at 25C The PHCP protein was air oxidized or reduced with a grain of sodium dithionite The protein concentrations were 6 and
20 lm for visible absorption and CD spectral analysis, respectively Pyridine hemochrome spectra were obtained according to the method described by Bartsch [26]
Isolation of full-length DNA encoding the PHCP protein
In order to clone the PHCP gene and to determine the complete DNA sequence, we used the PCR method From N-terminal sequence information on the PHCP protein up
to the 30th residue, we designed 512 mixed forward primers (PHcp01fw) corresponding to the resulting PHCP protein sequence Glu-Asp-Lys-Val-Lys-Phe-Arg-Glu-Ala (5th to 14th residues of the mature PHCP sequence, see Fig 2), and 18 432 mixed reverse primers (PHcp01rv) correspond-ing to the well-conserved cytochrome c¢ sequence Cys-Lys-Ala-Cys-His-Asp-X-Tyr-Arg (124th to 132nd residues in the case of PHCP, Fig 2; X denotes any residue), and used
Trang 7them to amplify H thermoluteolus chromosomal DNA with
Ex Taq polymerase (Takara, Shiga, Japan) The DNA
frag-ment obtained from PCR was sequenced and found to code
a part of the PHCP protein
We next used the inverse PCR method to obtain the entire
PHCP gene DNA fragments that had been prepared by
digestion of H thermoluteolus chromosomal DNA with
sev-eral restriction enzymes separately were self-ligated and then
used as the first PCR templates with a gene-specific reverse
primer, PHcp03rv, corresponding to the PHCP protein
sequence of the 31st to 40th residues (Fig 2), and a
gene-spe-cific forward primer, PHcp03fw, corresponding to the
sequence of the 45th to 53rd residues The resulting PCR
products were then used as the second PCR templates with a
gene-specific nested reverse primer, PHcp04rv,
correspond-ing to the protein sequence of the 27th to 31st residues, and
a gene-specific nested forward primer, PHcp04fw,
corre-sponding to the sequence of the 106th to 111th residues
Heterologous synthesis of the PHCP and PH c552
proteins by E coli
Escherichia coli DH5a was used for the maintenance and
propagation of all plasmids The E coli RI89, RI242 and
JCB387 strains were examined with regard to the synthesis
of exogenous PHCP and PH c552proteins The RI89 strain
is a parental strain of RI242, which is a dsbD null mutant
[27], and the JCB387 strain is usually used for heterologous
synthesis of cytochromes c in our laboratory [28] These
strains were transformed with pKK223-3 derivatives
carry-ing the PHCP or PH c552 gene (ampicillin resistance) The
original signal sequence of PHCP was replaced with that of
Pseudomonas aeruginosa cytochrome c551 to target the
PHCP apo-protein to the E coli periplasm by the PCR
method described previously for PH c552[12] The resulting
PHCP gene was flanked by artificially introduced restriction
sites (EcoRI, 5¢ and SalI, 3¢), and then inserted into the
corresponding sites of pKK223-3 The E coli JCB387 strain
was further co-transformed with pEC86 [29], which carries
the E coli cytochrome c maturation genes ccmABCDEFGH
(chloramphenicol resistance)
The transformed E coli RI89, RI242 and JCB387 cells
were grown in LB liquid medium containing appropriate
antibiotics overnight at 37C The resulting precultures of
RI89 and RI242 cells were each inoculated into 50 mL of
minimal medium supplemented with 0.4% (v⁄ v) glycerol as
a carbon source, and with nitrite and fumarate as
substrates for respiration, in a screw capped bottle, which
was then incubated anaerobically for 24 h at 37C [30]
The preculture of the JCB387 strain was inoculated into
20 mL of the same minimal medium supplemented with
0.4% (v⁄ v) glycerol in a 50-mL flask, which was then
incu-bated aerobically for 16 h at 37C [28] The growing
E coli cells at the late logarithmic phase were harvested
Periplasmic extracts of these cells were obtained by the cold
osmotic shock method [31], and then subjected to SDS⁄ PAGE, followed by heme staining of the gels in order
to detect holo-cytochromes c [24] The same extracts were subjected to visible absorption spectral analysis, as carried out for the purified PHCP protein
Reagents Restriction enzymes, T4 DNA ligase and other reagents for DNA handling were purchased from Takara All other chemicals used were of the highest grade commercially available
Acknowledgements
We wish to thank D Miyake, R Sano and S Fujii (Hiroshima University) for technical assistance This work was partly supported by a Grant-in-Aid for Scientific Research on Innovative Areas (No 20118005) from the Ministry of Education, Culture, Sports, Science and Technology of Japan
References
1 Ambler RP (1982) The structure and classification of cytochromes c In From Cyclotrons to Cytochromes (Kaplan NO & Robinson A eds), pp 263–280
Academic Press, New York
2 Ascenzi P, Santucci R, Coletta M & Polticelli F (2010) Cytochromes: reactivity of the ‘dark side’ of the heme Biophys Chem 152, 21–27
3 Hamada K, Bethge PH & Mathews SF (1995) Refined structure of cytochrome b562from Escherichia coli at 1.4 A˚ resolution J Mol Biol 247, 947–962
4 Weber PC, Salemme FR, Mathews FS & Bethge PH (1981) On the evolutionary relationship of the 4-a-heli-cal heme proteins J Biol Chem 256, 7702–7704
5 Page MD, Sambongi Y & Ferguson SJ (1998) Contrast-ing routes of c-type cytochrome assembly in mitochon-dria, chloroplast and bacteria Trends Biochem Sci 23, 103–108
6 Sambongi Y, Uchiyama S, Kobayashi Y, Igarashi Y & Hasegawa J (2002) Cytochrome c from a thermophilic bacterium has provided insights into the mechanism of protein maturation, folding, and stability Eur J Bio-chem 269, 3355–3361
7 Harris RL, Barbieri S, Paraskevopoulos K, Murphy
LM, Eady RR, Hasnain SS & Sawers RG (2010) Characterization of cycP gene expression in Achromo-bacter xylosoxidansNCIMB 11015 and high-level heterologous synthesis of cytochrome c¢ in Escherichia coli J Mol Microbiol Biotechnol 18, 102–108
8 Evers TH & Merkx M (2005) Successful recombinant production of Allochromatium vinosum cytochrome c¢
Trang 8requires coexpression of cmm genes in heme-rich
Escherichia coliJCB712 Biochem Biophys Res Commun
327, 668–674
9 McGuirl MA, Lee JC, Lyubovitsky JG, Thanyakoop C,
Richards JH, Gray HB & Winkler JR (2003) Cloning,
heterologous expression, and characterization of
recom-binant class II cytochromes c from Rhodopseudomonas
palustris Biochim Biophys Acta 1619, 23–28
10 Allen JW, Barker PD & Ferguson SJ (2003) A
cyto-chrome b562variant with a c-type cytochrome CXXCH
heme-binding motif as a probe of the Escherichia coli
cytochrome c maturation system J Biol Chem 278,
52075–52083
11 Barker PD, Nerou EP, Freund SM & Fearnley IM
(1995) Conversion of cytochrome b562to c-type
cyto-chromes Biochemistry 34, 15191–15203
12 Ichiki S, Nakamura S, Ohkubo T, Kobayashi Y,
Haseg-awa J, Uchiyama S, Nishihara H, Mizuta K &
Sam-bongi Y (2005) Cloning, expression, crystallization and
preliminary X-ray characterization of cytochrome c552
from a moderate thermophilic bacterium,
Hydrogeno-philus thermoluteolus Acta Crystallogr 61, 395–398
13 Kojima N, Yamanaka M, Ichiki S & Sambongi Y
(2005) Unexpected elevated production of Aquifex
aeoli-cuscytochrome c555in Escherichia coli cells lacking
disulfide oxidoreductases Biosci Biotechnol Biochem 69,
1418–1421
14 Kruglik SG, Lambry JC, Cianetti S, Martin JL, Eady
RR, Andrew CR & Negrerie M (2007) Molecular basis
for nitric oxide dynamics and affinity with Alcaligenes
xylosoxidanscytochrome c¢ J Biol Chem 282, 5053–5062
15 Chen YH, Yang JT & Martinez HM (1972)
Determina-tion of the secondary structures of proteins by circular
dichroism and optical rotatory dispersion Biochemistry
11, 4120–4131
16 Ren Z, Meyer T & McRee DE (1993) Atomic structure
of a cytochrome c¢ with an unusual ligand-controlled
dimer dissociation at 1.8 A˚ resolution J Mol Biol 234,
433–445
17 Allen JW, Sawyer EB, Ginger ML, Barker PD &
Fer-guson SJ (2009) Variant c-type cytochromes as probes
of the substrate specificity of the E coli cytochrome c
maturation (Ccm) apparatus Biochem J 419, 177–184
18 Goldenberg DP (1999) Finding the right fold Nat
Struct Biol 6, 987–990
19 Feng Y, Sliger SG & Wand AJ (1994) Solution
structure of apocytochrome b562 Nat Struct Biol 1,
30–35
20 Yamanaka M, Mita H, Yamamoto Y & Sambongi Y (2009) Heme is not required for Aquifex aeolicus cyto-chrome c555polypeptide folding Biosci Biotechnol Biochem 73, 2022–2025
21 Yamanaka M, Masanari M & Sambongi Y (2011) Con-ferment of folding ability to a naturally unfolded apocy-tochrome c through introduction of hydrophobic amino acid residues Biochemistry 50, 2313–2320
22 Hayashi NR, Ishida T, Yokota A, Kodama T & Igarashi Y (1999) Hydrogenophilus thermoluteolus gen nov., sp nov., a thermophilic, facultatively chemolitho-autotrophic, hydrogen-oxidizing bacterium Int J Syst Bacteriol 49, 783–786
23 Goto E, Kodama T & Minoda Y (1978) Growth and taxonomy of thermophilic hydrogen bacteria Agric Biol Chem 42, 1305–1308
24 Goodhew CF, Brown KR & Pettigrew GW (1986) Haem staining in gels, a useful tool in the study of bac-terial c-type cytochromes Biochim Biophys Acta 852, 288–294
25 Scopes RK (1974) Measurement of protein by spectro-photometry at 205 nm Anal Biochem 59, 277–282
26 Bartsch RG (1971) Cytochromes: bacterial Methods Enzymol 23, 344–363
27 Rietsch A, Belin D, Martin N & Beckwith J (1996) An
in vivopathway for disulfide bond isomerization Proc Natl Acad Sci USA 93, 13048–13053
28 Oikawa K, Nakamura S, Sonoyama T, Ohshima A, Kobayashi Y, Takayama SJ, Yamamoto Y, Uchiyama
S, Hasegawa J & Sambongi Y (2005) Five amino acid residues responsible for the high stability of Hydroge-nobacter thermophiluscytochrome c552: reciprocal mutation analysis J Biol Chem 280, 5527–5532
29 Arslan E, Schulz H, Zufferey R, Kunzler P & Tho¨ny-Meyer L (1998) Overproduction of the Bradyrhizobium japonicum c-type cytochrome subunits of the cbb3 oxi-dase in Escherichia coli Biochem Biophys Res Commun
251, 744–747
30 Sambongi Y & Ferguson SJ (1996) Mutants of Escheri-chia colilacking disulphide oxidoreductases DsbA and DsbB cannot synthesise an exogenous monohaem c-type cytochrome except in the presence of disulphide com-pounds FEBS Lett 398, 265–268
31 Sambongi Y, Stoll R & Ferguson SJ (1996) Alteration
of haem-attachment and signal-cleavage sites for Para-coccus denitrificanscytochrome c550probe pathway of c-type cytochrome biogenesis in Escherichia coli Mol Microbiol 19, 1193–1204