reservoir base fracture optimization approach

Finite time exergoeconomic performance optimization for an irreversible universal steady flow variable-temperature heat reservoir heat pump cycle model

Finite time exergoeconomic performance optimization for an irreversible universal steady flow variable-temperature heat reservoir heat pump cycle model

... Conclusion Finite time exergoeconomic performance of an irreversible universal steady flow heat pump cycle model with variable-temperature heat reservoirs, and the losses of heat transfer and internal ... All rights reserved. Finite time exergoeconomic performance optimization for an irreversible universal steady flow variable-temperatur...

Ngày tải lên: 05/09/2013, 15:28

18 610 0
Tài liệu Báo cáo khoa học: "Knowledge Base Population: Successful Approaches and Challenges" ppt

Tài liệu Báo cáo khoa học: "Knowledge Base Population: Successful Approaches and Challenges" ppt

... Arnold Jung and Ying Shi. 2010. LCC Approaches to Knowledge Base Population at TAC 2010. Proc. TAC 2010 Workshop. Paul McNamee and Hoa Dang. 2009. Overview of the TAC 2009 Knowledge Base Population ... rela- tionships, and employment relationships. 7 Toward System Combination The increasing number of diverse approaches based on different resources provide new opportu- ni...

Ngày tải lên: 20/02/2014, 04:20

11 413 0
Báo cáo hóa học: " Optimization of capsid-incorporated antigens for a novel adenovirus vaccine approach" doc

Báo cáo hóa học: " Optimization of capsid-incorporated antigens for a novel adenovirus vaccine approach" doc

... NSNAAAAAMQPVEDMNDHAIRGD TFATRAEEKRAEAEAAAEAA 53RGD motif- SGAEENSNAAAAAMQPVEDMNDHAIRGD TFATRAEEKRAEAEAAAEAAAPAAQ 63RGD motif- SNSSGSGAEENSNAAAAAMQPVEDMNDHAIRGD TFATRAEEKRAEAEAAAEAAAPAAQPEVEK 73RGD motif- GGAGGSNSSGSGAEENSNAAAAAMQPVEDMNDHAIRGD TFATRAEEKRAEAEAAAEAAAPAAQ PEVEKPQKKP 83RGD ... GGAGGSNSSGSGAEENSNAAAAAMQPVEDMNDHAIRGD TFATRAEEKRAEAEAAAEAAAPAAQ PEVEKPQKKP 83RGD motif- TEQGGGGAGGSNSSGS...

Ngày tải lên: 20/06/2014, 01:20

13 419 0
báo cáo hóa học:" Base of coracoid process fracture with acromioclavicular dislocation in a child" ppt

báo cáo hóa học:" Base of coracoid process fracture with acromioclavicular dislocation in a child" ppt

... shoulder with dislocation of the acromioclavicular joint and fracture of base of coracoid process. Figure 2 Axial CT image of the right shoulder with an intact epiphyseal plate of the coracoid process. Figure ... seen in children. A coraco id fracture can be isolated or associated with an injury complex, including any of acromiclavicular disruption, cla...

Ngày tải lên: 20/06/2014, 04:20

4 280 0
báo cáo hóa học:" Research Article A General Iterative Approach to Variational Inequality Problems and Optimization Problems Jong Soo Jung" ppt

báo cáo hóa học:" Research Article A General Iterative Approach to Variational Inequality Problems and Optimization Problems Jong Soo Jung" ppt

... Article A General Iterative Approach to Variational Inequality Problems and Optimization Problems Jong Soo Jung Department of Mathematics, Dong -A University, Busan 604-714, Republic of Korea Correspondence ... Theory and Applications Feasibility and Optimization and Their Applications (Haifa, 2000), vol. 8 of Studies in Computational Mathematics, pp. 473–...

Ngày tải lên: 21/06/2014, 11:20

20 367 0
Báo cáo hóa học: " Research Article The Displacement of Base Station in Mobile Communication with Genetic Approach" potx

Báo cáo hóa học: " Research Article The Displacement of Base Station in Mobile Communication with Genetic Approach" potx

... and the genotype can describe the number of base stations as well as the position of the base station, (ii) a chromosome expresses one base station position, (iii) the number of possible base station ... using fewer base stations. Therefore, the purpose of optimization in this paper is to determine the maximum traffic coverage with the minimum number...

Ngày tải lên: 21/06/2014, 22:20

10 382 0
A Service-Oriented Approach for Aerodynamic Shape Optimization across Institutional docx

A Service-Oriented Approach for Aerodynamic Shape Optimization across Institutional docx

... this collaboration, several observations may be made: 1) The Grid concepts and tools provide a workable alternative that enables collaboration across traditional institutional boundaries without ... (termination condition = false) gen = gen + 1; apply genetic operators to Pop(gen) evaluate fitness of the population end A Service-Oriented Approach for Aerodynamic Sh...

Ngày tải lên: 27/06/2014, 17:20

6 307 0
Báo cáo toán học: "On the Parametric Affine Variational Inequality Approach to Linear Fractional Vector Optimization Problems" pot

Báo cáo toán học: "On the Parametric Affine Variational Inequality Approach to Linear Fractional Vector Optimization Problems" pot

... investigate furthermore the parametric affine variational in- equality approach to linear fractional vector optimization problems, which can help to obtain tight upper estimates for the number of ... Mathematics 33:4 (2005) 477–489 On the Parametric Affine Variational Inequality Approach to Linear Fractional Vector Optimization Problems T. N. Hoa, T....

Ngày tải lên: 06/08/2014, 05:20

13 264 0
Báo cáo vật lý: "Effect of Filler Incorporation on the Fracture Toughness Properties of Denture Base Poly(Methyl Methacrylate)" pptx

Báo cáo vật lý: "Effect of Filler Incorporation on the Fracture Toughness Properties of Denture Base Poly(Methyl Methacrylate)" pptx

... 10Effect of Filler Incorporation on the Fracture Toughness Properties 4. CONCLUSION The general behaviour of the tested materials showed that the dry samples provided higher values of fracture ... 6Effect of Filler Incorporation on the Fracture Toughness Properties Figure 1: Effect of filler content on...

Ngày tải lên: 07/08/2014, 14:20

12 383 0
Báo cáo sinh học: "A combinatorial optimization approach for diverse motif finding applications" pdf

Báo cáo sinh học: "A combinatorial optimization approach for diverse motif finding applications" pdf

... basic motif finding case above, employing the same LP formulation and DEE techniques. Subtle motifs Another widely studied formulation of motif finding is the 'subtle' motifs formulation ... Central Page 1 of 13 (page number not for citation purposes) Algorithms for Molecular Biology Open Access Research A combinatorial optimization approach for diverse motif...

Ngày tải lên: 12/08/2014, 17:20

13 267 0
Báo cáo y học: "Severe hyperlactatemia with normal base excess: a quantitative analysis using conventional and Stewart approaches." ppt

Báo cáo y học: "Severe hyperlactatemia with normal base excess: a quantitative analysis using conventional and Stewart approaches." ppt

... 3 Research Severe hyperlactatemia with normal base excess: a quantitative analysis using conventional and Stewart approaches Graciela Tuhay, Mar a Carolina Pein, Fabio Daniel Masevicius, Daniela ... acquisition of data, and contributed to the analysis and interpretation of data. AD drafted the manuscript and performed the statistical analysis. All authors rea...

Ngày tải lên: 13/08/2014, 11:22

7 317 0
reservoir base fracture optimization approach

reservoir base fracture optimization approach

... shows a fracture profile as a function of all the fracture lengths for which the model has been run. Once the fracture dimensions are known as well as how the actual reservoir impacts fracture ... the fracture is designed so that the proppant reaches the tip of the fracture at the time the fracture reaches the desired length. When the proppant reaches the tip of the fra...

Ngày tải lên: 04/10/2014, 22:10

17 274 0
hydraulic fracture optimization in unconventional reservoir

hydraulic fracture optimization in unconventional reservoir

... multistage fractures in unconventional reservoirs. Further, it means that in general, anything that can be done to increase the conductivity of the fracture should yield a corresponding increase in ... using combinations of sliding sleeve and plug and perf methodology [Rankin, 2010]. In fact, it is rumored that some are contemplating as many as 50 stages in the future....

Ngày tải lên: 04/10/2014, 22:11

15 453 0
An ant colony optimization approach for phylogenetic tree reconstruction problem

An ant colony optimization approach for phylogenetic tree reconstruction problem

... nt Colony O p tim iza tion 20 3.1 The Ant Algorithms 20 3.1.1 Double bridge experim ents 20 3.1.2 Ant S y ste m 22 3.1.3 Ant Colony S y stem 24 3.1.4 Max-Min Ant System 25 3.2 Ant Colony Optimization ... Vietnam National University, Hanoi College of Technology Huy Quang Dinh An Ant Colony Optim ization Approach for Phylogenetic Tree Reconstruction Problem...

Ngày tải lên: 25/03/2015, 09:38

66 279 0
w